SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019961 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019961
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.37e-25
Family G proteins 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019961   Gene: ENSSHAG00000016936   Transcript: ENSSHAT00000020118
Sequence length 182
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864845.1:2416168:2418375:-1 gene:ENSSHAG00000016936 transcript:ENSSHAT00000020118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNLYTRQVQIEGETLAIQVQDTPGVQIHEQGLSCNEQLNRCIRWADAVVIVFSIIDYKSY
ELIGQLHQHVQQLHPGARLPVVIVANKADLLHIKQVEPQHGLQLANMLGCTFYEVSVSEN
YNDVYNAFHVLCKEVSHKQQVTSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVT
SV
Download sequence
Identical sequences G3WX06
ENSSHAP00000019961 ENSSHAP00000019961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]