SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020041 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020041
Domain Number 1 Region: 152-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-39
Family Eukaryotic proteases 0.00032
Further Details:      
 
Domain Number 2 Region: 56-117
Classification Level Classification E-value
Superfamily GLA-domain 9.42e-24
Family GLA-domain 0.00037
Further Details:      
 
Domain Number 3 Region: 106-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000464
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020041   Gene: ENSSHAG00000017001   Transcript: ENSSHAT00000020200
Sequence length 420
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849842.1:2449407:2480039:-1 gene:ENSSHAG00000017001 transcript:ENSSHAT00000020200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLDSIELAWTIRMAGCFWMLQLCFLAFSLHQSEQSVFWPASKANEVMVRAKRARSFILE
EILKGNLERECFEEICVYEEAREVFENNENTNSFWRQYMAGTPCISQPCLNNGVCMDNIR
SYICSCLEGFEGVNCEYAKNECHSKRSEGCDHFCHPGEEIFMCSCAKGYKLGKDHRSCIP
NEQCACGILSSKSNVTLKDDQLTLQNFPWQVKLTNSQGKDFCGGVIVQKNFVLTTAKCSL
LYGNISVKLSEDSVSGAPLEIKIKKKHVHMRYDQEMGQNNLALLELNEPIQCHSNGLPIC
IPEKDFAEHILIPEKMNVVSGWPFNGTELGDSLIDLPSVHFDNEKCEEILNVTITTRLFC
EQSKASVDWQLVEGSIVMAKHKGTWFLIGIMVSLPTENLGPLYLFTKISRYSIWFEQIMK
Download sequence
Identical sequences G3WX86
ENSSHAP00000020041 ENSSHAP00000020041 XP_003765774.2.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]