SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020100 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020100
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-57
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020100   Gene: ENSSHAG00000017051   Transcript: ENSSHAT00000020260
Sequence length 171
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861605.1:2478138:2489162:1 gene:ENSSHAG00000017051 transcript:ENSSHAT00000020260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIRAKVVGKKLVKEGPFGTLIYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKY
QYLITGRVYDGKMYTGLCNFVERWDRLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSK
NECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKTIINATDP
Download sequence
Identical sequences G3WXE5
ENSSHAP00000020100 ENSSHAP00000020100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]