SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020130 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020130
Domain Number 1 Region: 887-1084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.54e-40
Family Laminin G-like module 0.00087
Further Details:      
 
Domain Number 2 Region: 618-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.01e-38
Family Laminin G-like module 0.00045
Further Details:      
 
Domain Number 3 Region: 375-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-24
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 285-373
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-18
Family I set domains 0.045
Further Details:      
 
Domain Number 5 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 8-96
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-16
Family I set domains 0.008
Further Details:      
 
Domain Number 7 Region: 112-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000175
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 571-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020130   Gene: ENSSHAG00000017078   Transcript: ENSSHAT00000020290
Sequence length 1113
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849741.1:2494039:2513961:1 gene:ENSSHAG00000017078 transcript:ENSSHAT00000020290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EATVILHVESPPYATTIPEEALVGVGEMVQFQCLAHGTPPLTFHWSRVNGSLPRGATVRG
DLLRLHPAGPEDAGQYQCLVTNKVGSAQAIAHLRIQGENHGEAEGPFPAASAPAIHITPQ
HETKGIGGSVEFHCAVPSDAGAQIQWFKEGGQLPQGHTVQDGVLRIQNLDQSCQGTYICR
AHGPWGQVQDSAQLVVHALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPHVIWSKVGG
QLRSGIVQTGGTIRIAHVEQADAGQYRCTATNAAGTTQSHVLLLVQALPQISAPPEVRVP
AGSAAVFPCMASGFPTPDITWSKLEGDLPLGSHMENNVLTVPSVKPQDAGTYICTATNRQ
GKVKAFARLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIRINFRPDAADGMLIYSGQK
TAPGPGSPVNLAARQPDFISFGLVGGRPEFRRFDAGSGMATIRHPTPLALGQFHTVTLLR
NLTQGTLIVGNLPPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGFGRGRC
PALAPHPLLLQAVYLTLLSFSHPQPPTAPLRNGGFCQDSESSSYVCTCPSGFTGSRCEHS
QALHCHPASPEACGPDATCVNRPDGRGYSCRCHLGRFGEKCMEGVTVTTPALSGARSYLA
LPALTNTHHELRLDLEFKPLAPEGLLLFSGGKGAPVEDFVSLAMAGGHLEFRYELGSGTA
VLRSAQPLTLGHWHRVSAERFNKDGSLRVNGGHPVQRSSPGKSQGLNLHTLLYLGGVEPS
VTPPPAANVSAHFHGCIGEVSVNGKRLDMTYSFLGSSTPLALSGESGPRKGRPAPLLYTN
SHTAAPEHMAPAAILAPFPSGDHCEHAEHPCLLPEPCLHGGTCQGARCICPPGFTGPRCQ
KSRGSPEADWHLEGSGGNDAPGQYGAYFHDGGYLSFPNRVFPRSLPDIPETIELEVRTHT
PNGLLLWQGVEAREQGWGKDFISLGLQDGHLVFSYQLGSGEAHIISEDPINDGEWHKVTA
LREGRSGSIQVDGEELVSGQSPGPNVAVNTKGSIYIGGAPNAATLTEGRFEAGITGCIKN
LVLHCATPGGPPPQPLDLQHHVQAGANTRPCPS
Download sequence
Identical sequences G3WXH5
ENSSHAP00000020130 ENSSHAP00000020130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]