SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020224 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020224
Domain Number 1 Region: 2495-2759
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 734-995
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-48
Family YWTD domain 0.00000541
Further Details:      
 
Domain Number 3 Region: 1685-1939
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-46
Family YWTD domain 0.00000549
Further Details:      
 
Domain Number 4 Region: 1042-1307
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-42
Family YWTD domain 0.0000776
Further Details:      
 
Domain Number 5 Region: 23-264
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-40
Family YWTD domain 0.0000239
Further Details:      
 
Domain Number 6 Region: 1381-1630
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-36
Family YWTD domain 0.000035
Further Details:      
 
Domain Number 7 Region: 3351-3627
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-30
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 8 Region: 2030-2072
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000406
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 9 Region: 2440-2488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000185
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 2153-2193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 11 Region: 2281-2324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 561-602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 13 Region: 2923-2963
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000929
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 14 Region: 360-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 318-356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 16 Region: 2322-2364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 17 Region: 2198-2235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 18 Region: 402-439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 3089-3129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 20 Region: 3222-3258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 443-480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 22 Region: 2803-2841
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 3014-3051
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 525-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 25 Region: 3049-3089
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 26 Region: 2881-2924
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 27 Region: 2365-2405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 1994-2032
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 29 Region: 2844-2885
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 3136-3172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 649-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 32 Region: 481-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 2109-2155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 1315-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.023
Further Details:      
 
Domain Number 35 Region: 2407-2453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000222
Family EGF-type module 0.013
Further Details:      
 
Domain Number 36 Region: 686-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 37 Region: 3179-3216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 38 Region: 2240-2282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 39 Region: 606-642
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 40 Region: 2977-3010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 41 Region: 3303-3337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000027
Family EGF-type module 0.01
Further Details:      
 
Domain Number 42 Region: 2078-2113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000563
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 1639-1678,1939-2003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000879
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 44 Region: 3682-3713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000045
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020224   Gene: ENSSHAG00000017153   Transcript: ENSSHAT00000020384
Sequence length 3969
Comment pep:novel scaffold:DEVIL7.0:GL849632.1:2537844:2689360:-1 gene:ENSSHAG00000017153 transcript:ENSSHAT00000020384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAVRQFLLFSSQLAVRGIPFNLSTQEDVIIPVTGSPSYFVGIDFYAQEDTIFFSDTTKDI
IYKQKIDGTGREIITANRVESVEDLAFDWISKNLYWTDPRYRSISVMRLVDKSRRAIVQN
LNNPRSIVVHPVIGYIFWTDWYRPAKIMRAWSDGSHSVPIVNTTLGWPNGLALDWGALRL
YWVDAFFDKIEHSTFDGLDRRTLERIHQMTHPFGLTIFENYAYFTDWRLGGIVRVRKTDG
GEMTIIRRGINNVMHVKSYNANTQTGSNYCNRATNPNGDCSHFCFPVPNFQRVCGCPYGM
KLSSNHLTCVEDPSNEPPTLQCGSYSFSCNNGRCVPRYYRCDGVDDCHDNSDEQHCGTLN
NTCAASAFTCAHGQCIPGRWHCDRHNDCLDGSDEEHCPTLGPASCPESLYTCDNNQCIPR
IWLCDTDNDCGDGSDEKNCNFTGTCDPGQFQCPDHRCIDPFYVCDGDRDCADGADEVGCI
YNCTASEFKCASGDQCISNIYHCDGVFDCNDNSDEAGCPTRPPGMCHQNEFQCQSDGTCI
PNNWECDGHLDCMDGSDEHNGCLPMTCAPSLFRCDNGNCIYRAWICDGDNDCRDMSDERD
CPTQPFRCPSWQWQCPGHSICVNLSSVCDDIPDCPNGADESPVCNQESCSDNNAGCTHEC
IQGPFGAQCLCPFGYQLTNDSKTCEDINECETPGFCSQHCYNERGSSRCWCDEGYILEGN
GKTCKVAASGNLLLLVTSRNQIVADNITSQGDNIYSLIRDGEHIVAIDFDSLSGRIFWSD
IRQDKIWSAFQNGTDRKVIFDSGVTVTESIAVDWVGRNLYWTDYVLETIEVSKMDGNHRT
VLISENVTNPRGLVLDPRIDAHLMFWSDWGRNPRIERASMDGTNRTVIIKDKIYWPNGLA
IDYPNKLLYFMDAYLDYIDFCDYNGNHRRQVVASDLVLRHPHALTLFEDFVYWTDRHTHR
VIRANKWHGGNQTVIIYNIHQPLGIVAVHPVKQPSSTNSCISAPCSHLCLLSSSGPRFYS
CACPSGWTLSSDSINCLRDEQPFLITVRKNIIYGISLNPEEKTNDAMVPIAGIQNGYDVD
FDDSEQFIYWVENPGEIHRVKSDGTNRTVFAPASVLGSPASLALDWISRNLYYTNPGTQS
IEVLTLRGETKYRKSLITNDGTPLAVGFPVGITIDPANGKMYWTDHGTESGIPAKVASAN
MDGSQIKTLFTGNLEHIEFITIDIKEQKLYWAVTGTGVIERGNVDGTNRMIVVFHLSHPW
GIAVYDSFLYYTDQDYEVIERVDKATGANKVALRDNVPNLRCLRVYYRDHSAGSSNGCSN
NMNTCQQMCLPIPGGLFSCACATGFKLNPDNRTCSPYDSFIVVSMLTAIKGFSLEASDHS
EAMVPMAGRGRNALHVDVHVPSGFIYWCDFSSTVASQNGIRRIKPDGSNFRNVITNGIGQ
NGVRGIAVDWVAGNLYFTNAFGTETLIEVLRINTTYRRVLLKTTVDMPRHIVVDPKNRYL
FWADYGQNPKIERAFLDCTNRTVLVSEGIVTPRGLAVDHSNGYIYWVDDSLDIIARINQE
GGDTEMVRYGSRYPTPYGITVFENTMIWVDRNLKKIYQASKEPGNTDPPRVIRDNINWLR
DVTIFNPQFQPLLPEEVNHNPCLENYGGCSHLCFALPRVQAPKCGCAFGELESDGKRCAI
STENYLIFALENSLRSIYLDPENHSPPFRKLTVPRTAVALDFDSINNRIYFTQSSTSASG
RISYVSLLSGVTSPTVIATDVGIPDGIAFDWINSRIYYSDYLNQTINSMAVDGSNHTVVA
RVPRPRAIVLDPCRGYMYWTDWSTNAKIERATLGGNFRIHIVNTSLVWPNGLTLDYDEDW
LYWADANLQKIERSSLTGANREVIISTAIHPFAMTVYDQHIYWTDWNTRTIYRANKYDGS
EQIVMIMNLPLRPMDIHVLVKSRQQQCPNPCSQFNGGCSHICAPGPNGAECQCPSGGRWY
LANGNKHCITDNGTRCEGVQFTCLNGRCISERWKCDNDNDCGDGSDELESVCAFHTCQPT
AFTCGNGRCVPYHYRCDHYNDCGDNSDEAGCLFRTCDTNTEFACNNGRCISLEYVCNGIN
NCYDNGTTDERNCPDRTCQSGFTKCQNTNICIPRTYLCDGDNDCGDMSDESPTHCVSLTC
TSNEFRCTSGRCIPAHWYCDQGVDCADGSDEPSSCVSHVRTCRADQFRCDDGRCIPSTWT
CDGDNDCGDMSDEDQRHSCADRNCTRSEFTCVNNRPPLRRCIPRAWICDGDADCNDAYDE
HQNCTRRPCTENEFTCGNGLCIRNSYRCDRRNDCGDSSDERGCVYPPCQQYQFTCQNGRC
ISKAYLCDGDNDCGDLSDELEHLCITPEATCPPHQFKCDNGNCIEMTQICNHLDDCNDNS
DEKGCGINECNDPSISGCDHNCTDTQTSFYCTCLPGYKLMSDKKTCDDIDECNETPSVCS
QMCENTVGSYICKCARGYIREPDGKRCRQNSNISPYLIFSNRYYLRNLTADGQSYSLILQ
GLGMAVALDFDRVEQRLYWIDLEKQVIERMFLNGTNKETVINNNLPAGEGLAVDWVARKL
YWLDAYLNCLFVANLDGRFRRKLAEHCVDSNNTFCFQHPRGIVLHPKYGQVYWTDWADRP
YIGRVGMDGTNKTVIITTKLSWPNGITIDYTNDKLYWSDAHLSYIEFSDLEGRHRHTVFD
GTLPHPFAITIFEDTVFWTDWNTRTVEKGNKYNGSGRMVLVNTTHRPFDIHVYHPYRQPI
VNNPCGINNGGCSHLCLIKAGGQGFTCECPDNFQTLQLGSVTHCLPMCSSTQFLCGDSER
CIPIWWKCDGQKDCRDGSDEPSTCPPRYCQLGQFQCNDGNCTNPHFLCNTLRECPDGSDE
DHVLCVNHQCETHQWQCANKRCIPEAWQCDTEDDCGDNSDEDSAHCASRTCLPGQFKCDN
GRCIPQSWKCDVDNDCGDHSDEPVHECMGPEYRCDNHSDFSCKTNYRCIPRWAVCNGYDD
CRDNSDEQGCEEMTCNPLGDFRCNNHRCIPLRWKCDSYDDCGDESDEQNCTPRECSESEF
RCDNQRCVPSRWICDHDNDCEDNSDERDCEMRTCHPGFFQCNSGHCVPERFKCDGSADCL
DFSDEASCPTRYPNGTYCAATMFECKNHVCIQPFWKCDGDNDCGDNSDEELHLCLDSPCE
PPFRFRCENNRCIYSHELCNQEDDCGDGSDEKVEYCMNATSKPCTEDEFKCGNGHCIPLS
YVCDNFDDCGDHFDETGCNPGAERTCDENICEHNCTNLNEGGFICSCRPGYNASAIDRNS
CIDINECEQFGVCPQDCRNSKGSYECICADGFRSVGDHEGKQCAADGTPPLLLLPDNVRI
RKYNLSSEQYSDYLDNQEHIQAIDYDWDPEGIGLSVVYYTVLGQGSDFGSIKLYRAYISS
ETLGKNSSIHRDTCISEKEFLMQTHLVLPEVKFRHIYWSDASTNRIEVAKLDGRYRKWLV
STQLDQPAAVVVNPKLGVLFWTILGGRQPKIERAWMDGQQRQTLVSNDLGWPTGLSIDYL
NNDRIYWSDSKENIIESMRHDGTDRRLVSAGVGNPYSLDVFEGHLYWTSKERGEVWKEDK
FGRGERVKVLTVNPWLTQVRIYHQYRYNHSVPNVCKDICSHLCLLRPGGYTCSCPEGSRF
VEGSNTDCDAAIEPPPTMPPACRCMYGGTCYVDESDLPKCKCPNGYTGNYCELGFSRGMP
PGTTVAVLLTIILILLIGALAIGGFFNYKRTGSLLPSLPKLPSLSSLVKSTENGSGVTFR
SGADVSMDIGVSGFGPDSAIDRAMQMNENFAVETGKQPIIFENPMYAARDSVVNVDQPAT
ELYKTLIYLQVTEFRNEDNPNYENTISSSEIVVEEKQPSTSAETTQGAEAAQESKWSFFK
RKLKQSTNFENPIYAEMEKEQQEVTAAVPPPSPSLSADIIQRKDQTPAYIATEDTFKDTA
NLVKEDSEV
Download sequence
Identical sequences G3WXR9
ENSSHAP00000020224 ENSSHAP00000020224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]