SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020307 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020307
Domain Number 1 Region: 75-260
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-49
Family Astacin 0.00022
Further Details:      
 
Domain Number 2 Region: 426-579
Classification Level Classification E-value
Superfamily TRAF domain-like 9.65e-31
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 269-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-25
Family MAM domain 0.0087
Further Details:      
 
Domain Number 4 Region: 645-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000211
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020307   Gene: ENSSHAG00000017223   Transcript: ENSSHAT00000020468
Sequence length 719
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856888.1:2568874:2605486:1 gene:ENSSHAG00000017223 transcript:ENSSHAT00000020468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCTRATWSLSFILLFVFAASISIKPFSKENALDLDASKQRKDILEINLAAGLDLFEGDI
LLPENRNGLRDPTTRWKFPIPYILADNLGLNAKGVILYAFEMFRLKSCVDFKPYQGEDTY
IIFQEFDGCWSMVGDQHTGQNLSIGSGCDYKAIVEHELLHALGFYHEQSRSDRDDYVNIW
WDEVIPGFEHNFVTYNDSYITDLNTPYDYESLMHYAPFSFNKNESVPTVTAKIPAFDDII
GQRLDFSTIDLERLNRMYNCTATHTLLDYCTFEKQNICGMIQGTRDDADWIHERGDGPGK
EDHTLVGRCKEAGYFMYFNTSSGQTEEAALLESRILYPKRKQQCLQFYYKMTGSPLDRLV
VWVKRDDSTGNVRKLVKIQTFQGDNEYGWKIGHVTLREEVKFRYLFQGTKGDPQNSAGGI
FLDDVKGDMVFSPRFYSSEGYGYGVTLYPHGRNGTSRSGYVGLTFQLYSGENDAILEWPV
ENRQAIMTIVDNDPDPKKTMSSSMVFTTSKDHVSPDINNSNIWDRPSVVGKYEQSCNCYR
GISWGWSAIISHVQLQKRNFIKDDTLVIFVDFEDITHLNQTEVPVTSTRQSSSGLILQSQ
GLQTSEEDSQTETLEDQPSSLHRQTRSIENTGPLEDHNWPQYFRDPCEPNPCQNEGICVN
VKGMASCRCVSGHAFFYTGERCQAMQVHGSILGMMIGGVAGTIVLSIVIISMMSKRMSL
Download sequence
Identical sequences G3WY02
ENSSHAP00000020307 ENSSHAP00000020307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]