SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020322 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020322
Domain Number 1 Region: 116-177
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.8e-16
Family B-box zinc-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 17-111
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000401
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020322   Gene: ENSSHAG00000017235   Transcript: ENSSHAT00000020483
Sequence length 328
Comment pep:novel scaffold:DEVIL7.0:GL834659.1:2579531:2585757:-1 gene:ENSSHAG00000017235 transcript:ENSSHAT00000020483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKMDYSSFPRDCHTMDTLERQLICPICLEMFSKPVVILPCQHNLCRKCANDIFQSSNR
CLKTLPGTTLGSSGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESARPLLKPE
CPTCEEHEDEKINIYCVTCRVPTCSLCKVFGEHQACRVAPLSDVYEQHKSELTDGIRTLV
ASNERIQALIAELQNTCRNVEDNCKARKQTLCEKFERMAGILEERKEIMLQRVSYEQAEK
TRQLRALSEAYEARVEATSKLVNTALQASEEPQVPLFLQNAKVLIQKIAEAVGSPELETL
EPGFDNMEHYAVDFNEEERALYQLDFIK
Download sequence
Identical sequences G3WY17
ENSSHAP00000020322 ENSSHAP00000020322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]