SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020330 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020330
Domain Number 1 Region: 436-548
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-24
Family PDZ domain 0.0039
Further Details:      
 
Domain Number 2 Region: 565-670
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-23
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 3 Region: 219-313
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 324-423
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-21
Family PDZ domain 0.017
Further Details:      
 
Domain Number 5 Region: 40-93
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000011
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020330   Gene: ENSSHAG00000017242   Transcript: ENSSHAT00000020491
Sequence length 673
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849703.1:2586628:2661101:-1 gene:ENSSHAG00000017242 transcript:ENSSHAT00000020491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTNDEIASMEQNSSLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLD
TPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVCQD
VMQRCDLEAHLKNRCPGASRRRVALERRKTSKLKTEIENENGSNVTDHPGTSSPDNIGIG
TVPTERNLTSTSLPMWTDEPGLDNPAFEENTVADTSQPPPSLPEGEITTIEIHRSNPYIE
LGISIVGGNETPLINIVIQEVYRDGIIARDGRLLAGDQILQVNNFDISNVSHNYARAVLS
QPCSVLHLTVLRERRFGSRTYNHSDNNSLREESFHVILHKRDSNEQLGIKLVRRTDEPGV
FILDLLEGGLAAQDGRLSSNDRVLAINGHDLKHGTPELAAQIIQASGERVNLTISRPGKP
QTNSTNREPGTHSSSQHQAQQLYHSRPSSHKDLSQCVTCQEKHITVKKEPHESLGMTVAG
GRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTDLSHSEAVAVLKASAAS
PAVTLKALEVQIVEEQTQPNEEQPSTISENEYDASWSPSWIMWLGLPSVLHSFHDVVLRR
SNLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYYDGRLKCGDMIIAVNGLSTLGMSHS
ALVPMLKEQRNKI
Download sequence
Identical sequences G3WY25
ENSSHAP00000020330 ENSSHAP00000020330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]