SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020351 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020351
Domain Number 1 Region: 903-1033
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-46
Family Regulator of G-protein signaling, RGS 0.00000591
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-23
Family Synaptotagmin-like (S variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 155-236
Classification Level Classification E-value
Superfamily PDZ domain-like 6.12e-18
Family PDZ domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020351   Gene: ENSSHAG00000017263   Transcript: ENSSHAT00000020512
Sequence length 1039
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834651.1:2598090:2758920:-1 gene:ENSSHAG00000017263 transcript:ENSSHAT00000020512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLKLSIDKQDRVLLLYIIEAKDLMIKDSRPCDAYVKVSVVPDNDRKRRQKTQTIPDCKN
PAFHERFFFPIQEADEQKRLLVAVWNRERDSRQNQLIGCMSFGVKSLLAPDKEISGWYYL
LGQDLGLTKHLKVATRRLKKSRVPVIVLVFGGRYEPGKLLKITIPRGRDGFGFTICCDSP
VRVQAVDSGGPAERAGLQQLDTVLQLNEQPVEHWKCVELAHEIRNCPGEIILLVWRIIPQ
IKPGPDGGVLRRASCKSTHDLQSPPNKREKNSGLGTRPEQRRSCHLVCDSSDGLLVGGWE
RYSEVGKRAQHTLPPLSRPSAPPDPNYIILAPLNPGSQLLRPLYQEDSIPEVSSSPVSGT
IEFSILGKKLESIKTAELSQQHSALDNCNKIQYNIINYKIYKFVTVLKKLYLPPLFNQMK
KSMRRPSEILLIVLHLILCDFFFLAQVTLFVYSDLLLFTKEDEPGRCNVLRNPLYLQSIK
LQEGLSEDLKFCVLYLAEKAECLLTLEAYSQEQKKRVCWCLSKNIAKQQQLAAAPQESKQ
YHSQQKKKKKISAREGKIPGTLSSPPKIEPLPCGEVPPSYSLYPRLKSPDGDTPQPTRAL
VKESPTGQARATPTPPPEPHPRPPPRQQEECEGPPDAQNRQHCLDKKEGQKPQAQMRSHL
TLWLPAEECSPLRELAFCDELPPSIKKLRGKALMEDRSGRVSLLANPGSGPRLPAGRFLP
ARRAMVDFSEKDLERERQRQRETERERHRETETQRDRDTERQRHRERETKRRSSSILIGN
GRNSHLSHRRGETVYGTEESKGSREQGENSFTISLELTICFSPCPIPSPASEKRDLSKPG
PLEFHSEMLLSMYRTRSGNLQRRHTMKEAKDMKNRLGIFRRRNDSPGGNVAGKADKGMKS
LKPTSEEALKWGESLEKLLLHKYGLAVFRAFLRTEFSEENLEFWLACEDFKKVKSQSKMA
SKAKKIFSEYIAIQACKEVNLDSYTREHTKDNLQNVTRGCFDLAQKRIYGLMEKDSYPRF
LRSELYLDLINQKKLSPPL
Download sequence
Identical sequences G3WY46
ENSSHAP00000020351 ENSSHAP00000020351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]