SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020371 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020371
Domain Number 1 Region: 184-502
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-79
Family Protein kinases, catalytic subunit 0.0000015
Further Details:      
 
Domain Number 2 Region: 30-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-29
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020371   Gene: ENSSHAG00000017278   Transcript: ENSSHAT00000020532
Sequence length 548
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849907.1:2612029:2644021:-1 gene:ENSSHAG00000017278 transcript:ENSSHAT00000020532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGGLDNLIANTAYLQARDGDTKEMQKRRRSLALPAREHCAELRQALPTHFESMCEQQP
IGRRLFHDFLATVPAYKVAVDFLAEVSSWELAEEGSTKDSTLRGLVQLCAQATPTGQLPF
LSRALATKCQTASETEHASLVELAKAETMTFLQDQPFQDFQASPFFDRFLQWKAFEQQPI
TEKYFEEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKRGEQMALLEKEILEKV
NSPFIVTLAYAFESKSHLCLVMSLMNGGDLKYHIYHVGERGLEINRIIFYSAQITCGILH
LHSIGIVYRDMKPENVLLDDRGNCRLSDLGLAVQIKDGKSITQRYAGTNGYMAPEILKEE
ESYSYPVDWFAMGCTIYEMVAGRTPFKDYMEKVSKEDLKQRTLKEEVIFQHSGFTEEAKD
VCRLFLAKRAEQRLGSRGGGCSSIQKHSFFKTINFPRLEAGLVEPPFVPDPNVVYAKDVG
DIEDFSEVRGIEFDEKDRKFFKKFATGAIPIAWQEEIIETGLYEELNDPSRLGCVNDSTS
KSGVCVVL
Download sequence
Identical sequences G3WY66
ENSSHAP00000020371 ENSSHAP00000020371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]