SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020383 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020383
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily SET domain 2.22e-26
Family Histone lysine methyltransferases 0.065
Further Details:      
 
Domain Number 2 Region: 268-336
Classification Level Classification E-value
Superfamily TPR-like 0.0000261
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020383   Gene: ENSSHAG00000017288   Transcript: ENSSHAT00000020544
Sequence length 358
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856785.1:2617996:2676636:1 gene:ENSSHAG00000017288 transcript:ENSSHAT00000020544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEDWPMHKLECSAMCVFGENWNPSETVRLTARILAKQKTHHERTSSEKLLAVKEFESHLD
KLDNEKRELIQSDISALHHFYSKHIEYPDNASLVTLFAQVNCNGFTIEDEELSHLGSAIF
PDVALMNHSCCPNVIVTYKGTLAEVRAVQEINPGDEVFTSYIDLLYPTEDRNDRLKDSYF
FTCECRECTTKAKDKAKVEIRKLSEPPKAESIRDMVKYARNVIEEFRRAKHYKYSNATPS
ELLEICELSQEKMGSLFEDSNVYMLHMMYQAMGVCLYMQDWEGALRYGQKIIKPYSKHYP
LYSLNVASMWLKLGRLYMGLEHKASGVKALKKAIAIMEVAHGKDHPYISEIKKEIEDH
Download sequence
Identical sequences G3WY78
ENSSHAP00000020383 ENSSHAP00000020383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]