SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020398 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020398
Domain Number 1 Region: 1367-1509
Classification Level Classification E-value
Superfamily PH domain-like 1.3e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000437
Further Details:      
 
Domain Number 2 Region: 19-146
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-40
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 3 Region: 1215-1358
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-19
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020398   Gene: ENSSHAG00000017301   Transcript: ENSSHAT00000020559
Sequence length 1515
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849891.1:2626081:2727934:1 gene:ENSSHAG00000017301 transcript:ENSSHAT00000020559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSCRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSG
IYNVPGDSQTNICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVF
GKEDLDDAFKDDRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYD
NFNMHREDSMEEVVGHTQGPLDGSLYAKVKKKDCLHGSTGAVNAIRPTLSATPNHVEHTL
SVSSDSGNSRGPPNAPVSLSPEEKRELERLLSGFGLEREKQGPMYHSRHHLSRQHGGPAA
PSSGRHVVPAQVHVNGGTLPSERETDILDDELPNQDGHSVGSLGTLSSLDGVTNTSEGGY
PEAVSPLTNGLDKPYPAEPMVNGGSYPYEAHGRAPLAQMVHGAPLRPSFSAQEGLSGYQR
ESPNLGWQQAVTNPHYGYDVNGMFRSQSFPESEPQLPQAPARGGSSREAVQRGLNSWQQQ
QQQLQQQQQQPRPPPRQQERAHLENHSPRRPSPQPQVEASASGLPEFPRAASQKEIEQSI
EALNMLMLDLDPASSGSPLHKSQSVPGAWPGTSPLASQPPPGLSHQSQPLTQSRSGYISR
GHLQGTPEPVARTSLESVSPGRSYSPYDYQPSSAVSSYQPRSPASSSSAFPASSSPPGSR
QPPATLPGLTPQPQLLTKETGSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQTAEPPPPL
RRRAASDGQYENHSPEPTSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAF
EEMEGAAPASPPPSGGTVRSPPGLAKTPLSALGLKPHNPADILLHPTGEPRSYVESVART
AVAGPRTQDAEPKSPTILTTPTYGSETPLRNGTLGNSFAPPSPISTSSPLLGTDSTSMGS
FPSAESSGLGPRTPPQPVADASFHSGSLGPPPSSAQSSYQNISPTLPAVPSGHRSPDYFA
SDARPQSQFSVAGVHTLPGSPQTLHRTVGTNTPPSPGFGRRAVNPGMAAPSLGSPGLSRR
QVSSPHGNAMAGLHGNAIASPQSSMAASPGSPSLGRHPLGAVHSSSVTTPGSPGLGRHVA
GLGGAGPVVPGSPSMDRHAAYGGYSTPEDRRPTLSRQSSASGYQAPSTPSFPVSPAYYPG
MGSPTSSSPDSAAFRQGSPTPALPEKRRMSAGDRAGSLPNYATVNGKVSSSPISSGMSSP
SGGSMVSFSHTLPDFSKFSMPDNSPETRANVKFVQDTSKYWYKPEISREQAIIAITLLKD
REPGAFIIRDSHSFRGAYGLAMKVASPPPTILQQSKKGDMTNELVRHFLIETSPRGVKLK
GCPNEPNFGCLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSSANSTTDLLKQGAACN
VLFVNSVDMESLTGPQAISKATAETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRH
YPLNTVTFCDLDPQERKWTKAEGGVPAKLFGFVARKQGSTTDNACHLFAELDPNQPAAAI
VNFVSKVMLSAGQKR
Download sequence
Identical sequences G3WY93
ENSSHAP00000020398 ENSSHAP00000020398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]