SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020535 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020535
Domain Number 1 Region: 1065-1276
Classification Level Classification E-value
Superfamily SET domain 1.96e-71
Family Histone lysine methyltransferases 0.0014
Further Details:      
 
Domain Number 2 Region: 951-1079
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.56e-30
Family PWWP domain 0.00000283
Further Details:      
 
Domain Number 3 Region: 261-423
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.23e-27
Family PWWP domain 0.0052
Further Details:      
 
Domain Number 4 Region: 1298-1367
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000266
Family PHD domain 0.0036
Further Details:      
 
Domain Number 5 Region: 690-746
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000186
Family PHD domain 0.0091
Further Details:      
 
Domain Number 6 Region: 917-968
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000377
Family PHD domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020535   Gene: ENSSHAG00000017411   Transcript: ENSSHAT00000020698
Sequence length 1438
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834709.1:2703012:2801771:-1 gene:ENSSHAG00000017411 transcript:ENSSHAT00000020698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSFSFLQGIMGNTIQQPPQLIDSANIRQEDAFDNSSDIVEDGGQTPYETSLQQGFQYP
PTTEELPPITNGYPPSISMYEPQAKYQTYSQYPNGSANGFGAVRNFSPTDYYHTEISNTR
PHEVLEKPSPQQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEYAKSKHEGRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVVNILSEKPR
EDSMVLEETPVQQYLPSLPTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEQLLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYVDKQPEEVLSQAKKSAASKTEVKKNR
RPKTVLNTQPEQSNAGEAASSLSSTEIRRHSQRRHTSVEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNAAGDGKFIDQFVYSTKGVGNKTEISVRGQ
DKLIISTPNQRNEKATQNVSSPETTSGSTGSTEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQTTVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSTYRDTSDSDSRGLND
LQVSFGKQLDSPSAAADADASDVQSVDSSLSRRGTGNNKKDTVCQICESYGDSLVVCEGE
CCKHFHLDCLGLSSLPNGRFLCTECKTGQHTCFSCKVPGKDVKRCSVTACGKFYHEACVR
KFATAVFESRGFRCPQHCCSTCSMEKDIHKASKAGRMMRCLRCPIAYHSGDGCVAAGSLF
VSSYILICSNHSKRSSHSSSTVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNR
AELKLPMIPSSSASKKKCEKGGKLLCCESCPASFHPECLSIAMPEGCWNCNDCKAGKKLH
YKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFSY
VEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALELERNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCF
TKRLYPDAEVIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSITNF
YMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGVELTF
NYNLDCLGNGRTECHCGADNCSGFLGVRPKTAFASANEEKAKNAKLKQKKRKIKTEQKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDTCSNSAISFCE
FCPCSFCKDHEKGALVTSSLEGRLCCSKHNPKSPVAPEYWNKIRCKLESQEPGDEVKE
Download sequence
Identical sequences G3WYN0
ENSSHAP00000020535 ENSSHAP00000020535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]