SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020632 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020632
Domain Number 1 Region: 71-175
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-22
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 2 Region: 214-291
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-21
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 445-544
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-21
Family PDZ domain 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020632   Gene: ENSSHAG00000017497   Transcript: ENSSHAT00000020797
Sequence length 555
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864878.1:2755545:2813691:1 gene:ENSSHAG00000017497 transcript:ENSSHAT00000020797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHETMDVSVLVGDLKLVINEPSRLPLFD
AVRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRTHPEGLGISVRGGLEFGCGLFISHLIKG
GQTDNVGLQLGDEIVRINGYSISSCTHEEIINLIRTKKTVSIKVRHIGMIPVKNSPDESL
KWQFVDQFVAESGGGRGVVPSLGSRENREKKIFISLVGSRGLGCSISSGPTQKPGIFISN
VKPGSLSAEVGLETGDQIVEVNGIDFTNMDHKEAVNVLKSSRSLTISIVAGAQKGRELFM
TERERQAEVRQRELDRQELMLQKRLAMESNKILQEQQEKERQRKKEIAQKAAEENERYRK
EIEQITEDEERFKKQWEEEWGSKGQLLMPKTITAEVHTPPPRKPKYENMVKSPPHADDDL
NGETKNQPVQDFRKYEEDFNPYSMFLPEQIMGKDVRLLRIKKEGSLDLAVEGGVDSPIGK
IVVSAVYEDGAADRHGGIVKGDEIMAINGRIVMDFTLAEAQAALQKAWNQGGDWIDLVIA
VSPPKEYDDELLSFF
Download sequence
Identical sequences G3WYX7
ENSSHAP00000020632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]