SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020688 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020688
Domain Number 1 Region: 43-417
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.22e-46
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 542-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020688   Gene: ENSSHAG00000017544   Transcript: ENSSHAT00000020853
Sequence length 608
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834452.1:2792649:2943042:1 gene:ENSSHAG00000017544 transcript:ENSSHAT00000020853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLGWFPLPSEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFE
IVVAGYNGPNLVLKYDRAQRRLVNIAIDERSSPYYALRDRQGNAIGVTACDIDGDGREEI
YFLNTNNAFSGVATYTDKLFKFRNGHWEDILSDEVNVRRGVASRFAGRSVACVDRTGSGR
YSIYIANYANGNVGPDALIEMDPEASDLSRGIVALSDVAAEAGVSKYTGGRGVSVGPILS
SSASDIFCDNENGPNFLFHNQGDGTFIDVAASTGVDDPQQHGRGIALADFNRDGKVDIVY
GNWNGPHRLYLQMTTHGKVRFRDIATPKFSMPSPVRTVIAADFDNDQELEVFFNNIAYRG
SSANRLFRVIRREHADPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLVLSHGESMAQ
PLSVFRGNQGFKNNWLRVVPRTQFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPV
AHFGLGQDEPSSVEVTWPDGRVVSRGVASNETNSVLEIPYPREEDGPLKPTTLECGQGFS
QQDNGRCMDTDECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNEDGTACVAKMA
PRWLLASL
Download sequence
Identical sequences G3WZ33
ENSSHAP00000020688 ENSSHAP00000020688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]