SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020984 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020984
Domain Number 1 Region: 128-375
Classification Level Classification E-value
Superfamily vWA-like 3e-85
Family Integrin A (or I) domain 0.000000000806
Further Details:      
 
Domain Number 2 Region: 371-461
Classification Level Classification E-value
Superfamily Integrin domains 4.92e-32
Family Integrin domains 0.00000475
Further Details:      
 
Domain Number 3 Region: 627-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-22
Family Integrin beta tail domain 0.00001
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000377
Family Plexin repeat 0.0000636
Further Details:      
 
Domain Number 5 Region: 585-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Integrin beta EGF-like domains 0.00067
Further Details:      
 
Domain Number 6 Region: 543-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Integrin beta EGF-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020984   Gene: ENSSHAG00000017793   Transcript: ENSSHAT00000021154
Sequence length 784
Comment pep:novel scaffold:DEVIL7.0:GL856830.1:2987385:3056245:1 gene:ENSSHAG00000017793 transcript:ENSSHAT00000021154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRELCLALLALGALTGRVRGANVCTTRGVSSCQQCLAVSPLCAWCSDEDLAPGPSRCD
LKENLLKEGCAPESIEFPVSQITVLEARPLSNTGSGDSSMITQVSPQKIELRLRPDDSQT
FSVQVRQVEDYPVDIYYLMDLSNSMRDDLQKIQSLGTKLASEMRKLTSNLRIGFGAFVDK
PISPYMYISPPEALKNPCYEMKTTCLPMFGYKHVLTLTDQVTRFNEEVRKQNVSRNRDAP
EGGFDAIIQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLSGIVQPNDGECHIGSDN
HYSASTTMDYPSLALMTEKLSQKNINLIFAVTRSVVSLYQNYSELIPGTTVGTLSADSSN
VLQLIVDAYGKIRSKVELEIRDLPEELSLFFNATCLNNEVIPGLKSCVGLKIGDTVSFSI
EAKVRGCPQEKKKSFTIKPVGFKDKLTVSVTFDCDCACQAQAEPQSNRCNQGNGTFECGV
CRCGPGWLGAQCECSEEDYRPSQQDECSPQEGQPACSQRGECLCGQCVCHSSDFGKVTGK
YCECDDFSCVRFKGEMCSGHGQCSCGDCLCDSDWTGDYCNCTTRTDMCMSSNGLLCSGRG
QCICGKCVCTQPGSYGDTCEKCPTCPDACTFKKDCVECQKFSRGAWFEENICNNYCRDEI
VPVTELMDTGMEAVNCTYKDEDDCVVRFQYYEDSSGKSILYVVNEPDCPKGPDILVVLLS
VMGAILLIGLATLLIWKLLITIHDRREFAKFEEERARAKWDTANNPLYKEATSTFTNIAY
RGNS
Download sequence
Identical sequences G3WZX9
ENSSHAP00000020984 ENSSHAP00000020984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]