SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020985 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020985
Domain Number 1 Region: 129-376
Classification Level Classification E-value
Superfamily vWA-like 3e-85
Family Integrin A (or I) domain 0.000000000806
Further Details:      
 
Domain Number 2 Region: 372-462
Classification Level Classification E-value
Superfamily Integrin domains 4.92e-32
Family Integrin domains 0.00000475
Further Details:      
 
Domain Number 3 Region: 628-712
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-22
Family Integrin beta tail domain 0.00001
Further Details:      
 
Domain Number 4 Region: 25-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000523
Family Plexin repeat 0.0000636
Further Details:      
 
Domain Number 5 Region: 586-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Integrin beta EGF-like domains 0.00067
Further Details:      
 
Domain Number 6 Region: 544-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Integrin beta EGF-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020985   Gene: ENSSHAG00000017793   Transcript: ENSSHAT00000021155
Sequence length 784
Comment pep:novel scaffold:DEVIL7.0:GL856830.1:3004127:3056245:1 gene:ENSSHAG00000017793 transcript:ENSSHAT00000021155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSPPAWPPVFLSLRLLGSIGKRANVCTTRGVSSCQQCLAVSPLCAWCSDEDLAPGPSRC
DLKENLLKEGCAPESIEFPVSQITVLEARPLSNTGSGDSSMITQVSPQKIELRLRPDDSQ
TFSVQVRQVEDYPVDIYYLMDLSNSMRDDLQKIQSLGTKLASEMRKLTSNLRIGFGAFVD
KPISPYMYISPPEALKNPCYEMKTTCLPMFGYKHVLTLTDQVTRFNEEVRKQNVSRNRDA
PEGGFDAIIQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLSGIVQPNDGECHIGSD
NHYSASTTMDYPSLALMTEKLSQKNINLIFAVTRSVVSLYQNYSELIPGTTVGTLSADSS
NVLQLIVDAYGKIRSKVELEIRDLPEELSLFFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEKKKSFTIKPVGFKDKLTVSVTFDCDCACQAQAEPQSNRCNQGNGTFECG
VCRCGPGWLGAQCECSEEDYRPSQQDECSPQEGQPACSQRGECLCGQCVCHSSDFGKVTG
KYCECDDFSCVRFKGEMCSGHGQCSCGDCLCDSDWTGDYCNCTTRTDMCMSSNGLLCSGR
GQCICGKCVCTQPGSYGDTCEKCPTCPDACTFKKDCVECQKFSRGAWFEENICNNYCRDE
IVPVTELMDTGMEAVNCTYKDEDDCVVRFQYYEDSSGKSILYVVNEPDCPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRREFAKFEEERARAKWDTANNPLYKEATSTFTNIA
YRGN
Download sequence
Identical sequences G3WZY0
ENSSHAP00000020985 ENSSHAP00000020985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]