SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021118 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021118
Domain Number 1 Region: 1162-1389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-38
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 2 Region: 231-343
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-31
Family Cadherin 0.00078
Further Details:      
 
Domain Number 3 Region: 336-441
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-28
Family Cadherin 0.00088
Further Details:      
 
Domain Number 4 Region: 621-733
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 5 Region: 121-229
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 16-119
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 721-836
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 436-569
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 9 Region: 1412-1608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-24
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 10 Region: 544-620
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000675
Family Cadherin 0.0094
Further Details:      
 
Domain Number 11 Region: 829-919
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000857
Family Cadherin 0.0062
Further Details:      
 
Domain Number 12 Region: 1739-1779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 13 Region: 1612-1646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000444
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1647-1690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021118   Gene: ENSSHAG00000017906   Transcript: ENSSHAT00000021288
Sequence length 2584
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856988.1:3088065:3133330:1 gene:ENSSHAG00000017906 transcript:ENSSHAT00000021288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGDLPGSRRKRNVNTAPQFQSPVYQATVPENQPVGTPVASLRAVDPDEGEAGRLEYTMDA
LFDSRSNQFFSLDPVTGAVTTAEELDRETKSTHVFRVTAQDHGTPRRSALATLTITVTDT
NDHNPVFEQSEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRLVEGPGGPPPEVFEI
DPRSGVIRTRGPVDREAVESYQLTVEASDQGRDPGPRSATATVCLSVEDDNDNAPQFSEK
RYVVQVREDVTPGAPVLRVTATDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPL
DYETAKEYTLRIRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGY
LVLHIQAIDADAGDNARLEYRLAGVGPDFPFTINNGTGWISVAAELDREEVDFYSFGVEA
RDHGTPPLTASASVSVTILDVNDNNPTFTQPEYAVRLNEDAAVGTSVVTVSAVDRDAHSV
ITYQIASGNTRNRFSITSQSGGGLISLALPLDYKLERQYVLAVTASDGTRQDTAQVVVNV
TDANTHRPVFQSSHYTVNVNEDKPXSIPQFRIDGDTGAVTTQAELDYEDQVSYTLAITAR
DNGIPQKSDTTYLEILVNDVNDNAPQFLRESYQGSIYEDVPPFTSVLQISATDRDSGLNG
RVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAFAVDKGVPPARTPVEVM
VTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEV
FQLDIFSGELTALVDLDYETRAEYVLVIQATSAPLVSRATVHVRLLDRNDNPPVLGNFEI
LFNNYVTNRSSSFPGGAIGRVPAHDPDVSDTLSYSFERGNELSLVLLNTSTGELRLSKAL
DNNRPLEAIMSVSVTEGEHFWTGLCSQYLGGQFRTGVVTVITIALGNVSSSKFLPYFLSV
LFSSLSSVLSDTYYVIMYVRVQCNCDFASSVTELISYGQLPWGWRSCFQAAGGAREECLI
NSCLLTTLPKKELISLKHFENHCLRKPLYYMELEVLLIELNAPITSPPGVDFPELHYITA
FQPKKTPRSRGDYISEGVTLRGCKDNPLGNKKENRREERGISSSCWAQFSGGSGEHCEVS
ARSGRCAPGVCKNGGTCVNLLVGGFKCDCPSGDYEKPYCQVTTRSFPARSFLTLRGLRQR
FHFTLALTFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVSPFIPGG
VSDGQWHTVQLQYYNKPLLGRSGLPQGPSELKVAVVTVDDCDPGVALRFGAVLGNYSCAA
QGTQAGSKKSLDLTGPLLLGGVPDLPESFPIRTRHFVGCMRNLQVDSRRVDMADFIANNG
TVPGCPAKKNVCDSNTCQNGGTCVNQWDTFSCECPLGYGGKSCAQEMANPQRFLGRSLMA
WHGLALPITQSWHLSLMFRTRQADGILLQGITRGHSTITLEMREGHVLLSVEGTGVQTSF
LRLEPGRANDGDWHHVQLVLGVSGGAREPGHAVLSFDYGQQQAEGNLGPRLHGLHLTNVT
VGGAAGPGGSVAQGFRGCRQGVRVGEAADGASSLDPSRAERANVEQGCSLPDPCDSNPCP
TNSYCSDDWDSYSCSCDPGYYGDSCANVCTLNPCEHQSVCTRKPSAPHGYTCECPHNYFG
PYCETRYVAERCQGWHLYPGCGPCGPVGRGTSPGGKRASGQSCRENHYRPLGSPACLLCD
CYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTANGCEVNYDSCPRAIEAGIW
WPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPDLFNCTSVTFSELKGFAERLQRNES
GLDAGRSQRLAVLLRNATQHTAGYFGSDVKVAYQLATKLLAHESVQRGFGLAATQDVHFT
ENLLRVGSALLDVGNKRHWELIQQTEGGTAWLLHHYEAYASALAQNMRHTYLSPFTIITP
NIVISVVRLDKGNFAGAKLPHYEALRGERPPDLETTVILPESVFKATESQGVPVVPGEAR
EQEELGRRQRRHPELSQGQAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVINTPVVSI
SVHDDEDQLPRALDKPVTVQFRLLETEERSKPICVFWNHSILVSGTGGWSARGCEVVFRN
ESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTVTYAALGVTLAALLLTFLFLASLRALR
SNQHGIRRNLVAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCAFSWALLEALHLY
RALTEVRDVNTGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLIWSFAG
PVAFAVSMSVFLYLLAGRASCAAQRQGFEKKGTVSGLRSAFAVLLLLSATWLLALLSVNS
DALLFHHLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSHKPNPDPALTTKSTLTSPQS
YNCPSPYVDGRLYQPYGDSAGSLHSASRSERERKEESSLNTGQGPAALGDPGVLFLEAQD
QQHGPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEDGAFPGEPGWDSLLGPGAERLPLH
STPK
Download sequence
Identical sequences G3X0B3
ENSSHAP00000021118 ENSSHAP00000021118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]