SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021136 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021136
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-16
Family V set domains (antibody variable domain-like) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021136   Gene: ENSSHAG00000017919   Transcript: ENSSHAT00000021306
Sequence length 232
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856883.1:3100313:3109026:-1 gene:ENSSHAG00000017919 transcript:ENSSHAT00000021306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLSLLILLSITELSHTHNTTVLQVMEGQTLSISCPYDPVKYWGKLKSWCRQHEQQGHC
QHVISARRSWLIAFLKKWNGSTAIADDALAGRLTITLKDLRPHDTGLYQCQSHQNGMTDT
LRKIMVEVLEDSVGPQSSGDSWIPEEPEILEKHQSPEEPNVQSSVSRSLSETRNPLSPTI
FFFLVAGLLLSKFLAVGFLWIIAWHKKSQKKKPECGHSHDYQLQPLPGQDEV
Download sequence
Identical sequences G3X0D1
ENSSHAP00000021136 ENSSHAP00000021136 XP_003769092.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]