SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021152 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021152
Domain Number 1 Region: 117-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-33
Family DEP domain 0.0048
Further Details:      
 
Domain Number 2 Region: 28-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.79e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 3 Region: 309-354
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000168
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021152   Gene: ENSSHAG00000017931   Transcript: ENSSHAT00000021322
Sequence length 362
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841386.1:3183665:3255909:1 gene:ENSSHAG00000017931 transcript:ENSSHAT00000021322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKGGRQRQKEREREREEKGKGKRKRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLI
DRKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKVFM
RGQRLYEKLMSSENTLLQPREEEGIKYERTFMASELLDWLVQEGEATTRNEAEQLCHRLL
EHGIIQHVSNKHTFVDSNLLYQFRMNFRRRRRLMELLNERSPSSQETHDSPFCLRKQNSD
NRKPTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPV
TSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKSESLPQC
FH
Download sequence
Identical sequences G3X0E7
ENSSHAP00000021152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]