SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021193 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021193
Domain Number 1 Region: 772-1001
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-63
Family DBL homology domain (DH-domain) 0.00000000111
Further Details:      
 
Domain Number 2 Region: 374-563
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.68e-54
Family Regulator of G-protein signaling, RGS 0.0000161
Further Details:      
 
Domain Number 3 Region: 1005-1135
Classification Level Classification E-value
Superfamily PH domain-like 9.12e-39
Family Pleckstrin-homology domain (PH domain) 0.00000157
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 4.53e-17
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021193   Gene: ENSSHAG00000017964   Transcript: ENSSHAT00000021363
Sequence length 1542
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849656.1:3138673:3216575:-1 gene:ENSSHAG00000017964 transcript:ENSSHAT00000021363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHLSVYLLTNLFIIYFKLRHASILTRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEE
SRSETYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVLGC
NILHSNFLELRKTFKSGSYVALTVQGRPPGSPQIPLADSEVEPAAFGHMSPIMTSPHSPG
TSGNTERITSPVLMGEENNVVHNQKVEILRKMLQQEQERLQFLQEDYSRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSTQKCFKGAVQHNFWPIIGDSLPLSEVEADSGDGLGRIDYSS
GDGSRPNSDIADSPRSGLKERIYLEESPEKSEMIPDNDTQSNIGSPLIRTAPQIIGAEDD
DFGTEHEQINGQCSCFQSIELLRSRPAHLAAFLHHVVSQFDPATLLCYLYSDLYKQTNSK
ETRRIFLEFHQFFLDRAAHLKVSVPDEISLDLGKLFLRNFQVISLQGHFNQTMQDKVYPE
VQKHLEDFRQKRSMGLTLAESELTKLDAERDRDRVILEKERACAEQIITKIEELLMTAQA
VEEDKSSTMQYVILMYMKHLGVRVKEPRNLEHKRGRIGFLPKIKQSIKKDREGEEKVKRR
GFPSILGPPRRPSRHDSSAIGRAMELQKQRHPKHLSTPSSVSPEPQDSAKLRQSGISSDA
ADVMYMPPNPMSSLTSGTSASQDGGKENEMGSKQIGEGPASGDSTDGTPRTPNTVFDFPA
PPLDQLQEEEGEIERFPEHGTPKSFRKLDSIAFGESQSEDEQFENDLETDPPNWQQLVSR
EVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSSSELRRIFSNL
EEILQLHIGLNEQMKAVRKRNETSVIDEIGEDLLIWFSGSGEEKLKHAAATFCSNQPFAL
EMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTERPK
EREKVKKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDL
TKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHT
FSPVIKLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKAVWQDLIGRMALTVK
EQSTKPIPLPESPPCEGEREEEEASKLKEESHDVSTSSLQSPEKQMGAETSLMSKPQSPS
SVISGKSEISDLLAERQFEKEQMEETSKESGMDFQSTIPEPHLPVCEERWALDALRNLGL
LKQLLVQQLGLTEKRTPEDWPHFSRFRTSSQGVQVESPGVSQNVLDHSENNKTSQFGEGH
TSLQTRTGQIACYSPRTSIESPVPQDYMELASQDSRASNLLVMDHMIMTPEPSSAELEGG
PDDSGEHFFDAREAHSDDNPSESDGTERKEEEALQLRISGNVLILDGFETVQESSTEEEG
VSNLPSVGWAHQQQSVLNPRSDGGGSPFTPEFLVQQRWRPGEESGFSAQSPSSSADSHSQ
IMQYIRKIEADLEHLKKVEESYMTLCQRLAGSALTEEHSDKS
Download sequence
Identical sequences G3X0I8
ENSSHAP00000021193 ENSSHAP00000021193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]