SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021257 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021257
Domain Number 1 Region: 31-162
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-45
Family Regulator of G-protein signaling, RGS 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021257   Gene: ENSSHAG00000018017   Transcript: ENSSHAT00000021429
Sequence length 171
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856964.1:3183598:3198737:-1 gene:ENSSHAG00000018017 transcript:ENSSHAT00000021429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVRNEDRGDNAGRPTHTTKMESIQAVEECQNPTPDEIMSWSQNFDKMMKTPAGRNLFRE
FLRTEYSEENLLFWLACEDLKKEQNKKVVEEKARLIYEDYISILSPKEVSLDSRVREVIN
RNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSLIESTAGSSTSES
Download sequence
Identical sequences G3X0Q2
ENSSHAP00000021257 ENSSHAP00000021257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]