SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021362 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021362
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.01e-17
Family PWWP domain 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021362   Gene: ENSSHAG00000018105   Transcript: ENSSHAT00000021535
Sequence length 179
Comment pep:novel scaffold:DEVIL7.0:GL834466.1:3256872:3269398:-1 gene:ENSSHAG00000018105 transcript:ENSSHAT00000021535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPQQIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEG
LWEIENNPRVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGS
KRKKSYTSKKSSKQSRKSPADEDDKDCKEEENKSGSEAGDAGNDTRNTSSDLQKTSEGV
Download sequence
Identical sequences G3X107
ENSSHAP00000021362 ENSSHAP00000021362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]