SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021548 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021548
Domain Number 1 Region: 700-808
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 181-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 141-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000122
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 519-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000065
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 5 Region: 2-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 6 Region: 575-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021548   Gene: ENSSHAG00000018253   Transcript: ENSSHAT00000021722
Sequence length 886
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864880.1:3389384:3480065:-1 gene:ENSSHAG00000018253 transcript:ENSSHAT00000021722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYECQCNEGFFLSDNQHTCIHHAEEGLSCLNKDHGCGHLCKETLEGGVTCDCRLGFAL
AKNQRDCILTCNHGNGGCQHICVDTDEGPECSCHPKYRLHTDGKSCLEKEESTLELMKNN
VTSPIADVDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPMGFTLQFDGKTCKDID
ECQTDNGGCDHFCKNTVGSFDCSCKKGYKLLTDEKSCQDIDECSFERTCDHTCINHPGTF
ECACNKGYTLYGFTHCGDTNECSINNGGCQQTCVNTLGSYECQCPSGHQLHWNKKDCVEV
KGFLPGNISPKVSMRCTKIDGVDKCYLNCPSDVRLFPGYQDTYSVSCGTSSRLRSRLRKS
NDSALLDVATVRTSVTFRLNEGKCSLKKAELLSEDLSGIISEKYSSVKESFHYVNLTCGS
GKQVPGAFGRPAPTKEMFISVDFELEANQQEVTASCDLSCVLKKTEKKLRKVIRTLRKTV
HREQFHLRLSGMDFEVAKKFPRVSEHLADPCGLGQEHRKGKCVSCSVGTYDGRQGQCLLC
PNGTYQDEEGQITCKPCPNFEKAGSPKTLGARNMSECGGQCLPGEYSSNGFSPCQPCPLG
TYQPEVGRTSCFPCARSWRGELTTKHPGATTFQDCEAKVQCSPGHFYNTTTHRCIRCSAG
TYQPEFGKNYCISCPGNTTTDFDGSTNVTQCKNRHCGGELGEFTGYIESPNYPGNYPANT
ECTWTINPPPKRRILIVVPEIFLPIEDECGDYLVMRKTSSSNSVTTYETCQTYERPIAFT
SRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKL
IKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences G3X1J3
ENSSHAP00000021548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]