SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021620 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021620
Domain Number 1 Region: 402-567,626-779
Classification Level Classification E-value
Superfamily L domain-like 2.67e-46
Family Ngr ectodomain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 181-387
Classification Level Classification E-value
Superfamily L domain-like 6.8e-42
Family Ngr ectodomain-like 0.00023
Further Details:      
 
Domain Number 3 Region: 1048-1238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.57e-37
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 4 Region: 39-149
Classification Level Classification E-value
Superfamily L domain-like 1.09e-25
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 5 Region: 899-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000583
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 976-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000327
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 7 Region: 819-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000495
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 862-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000796
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 941-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000538
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021620   Gene: ENSSHAG00000018310   Transcript: ENSSHAT00000021794
Sequence length 1375
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864864.1:3452618:3606319:-1 gene:ENSSHAG00000018310 transcript:ENSSHAT00000021794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVKMEKYQNSKPQNNLKLSSLVLKIFLKESFCYTAPVFFSDLSENQIQAIPRKAFRGAV
DIKNLQLDYNHISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNL
FCDCHLAWLSDWLRQRPRVGLYTQCMGPNHLKGHNVAEVQKREFVCSGHQSFMAASCSVL
HCPAACTCSNNIVDCRGKGLPEIPTNLPETITEIRLEQNSIKVIPPGAFSPYKKLRRIDL
SNNQISEIAPDAFHGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDA
FQDLHNLNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNPIE
TSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADLACPEKCRCEGTTVDC
SNQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFE
GASGVNEILLTSNRLENVRHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYD
NQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGDWLRKKRIVTGNPRCQKPYFLKE
IPIQDVAIQDFTCDDGKSGNDDNSCSPLSRCPAECTCLDTVVRCSNKGLKALPKGIPKDV
TELYLDGNQFILVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCI
PSRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSSLSHLAIGANPLHCDCNMQWLSDWVKS
EYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVDVNILAKCSPCLSNPCKNDGTCNND
PVDFYRCTCPYGFKGQDCDVPIHSCISNPCKHGGTCHLKEGEKDGFWCTCADGFEGENCE
VNIDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILT
PKGYKCDCTPGYVGEHCDIDYDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPP
MVLPRTSPCDNFECQNGAQCIIKTNEPICQCLPGYQGEKCEKLVSVNFVNKESYLQIPSA
KVQPQTNITLQVATDEDSGILLYKGDRDHLAVELYPGRVRASYDTGAYPASAIYSVETIN
DGNFHIVELITMGQSLSLSIDGGSPKTITNLSKQSTLNFDSPLYVGAGMPGKSNVAALRQ
APGRNSTSFHGCIRHLYINSELQDFRKVPMQTGILPGCESCKCLEGYGGVLCDEEEQPFN
PCQAIRCKHGKCRLSGLRQAYCECHGGFTGESCDREVSCRGERVRDHYQRQRGYAACQTT
KKVSRLECRGGCAGGQCCGPLRSKRRKYAFECTDGSSFVDEVEKVVKCGCARCPA
Download sequence
Identical sequences G3X1R5
ENSSHAP00000021620 ENSSHAP00000021620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]