SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021791 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021791
Domain Number 1 Region: 230-321
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-21
Family PDZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 349-448
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 3 Region: 121-213
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-20
Family PDZ domain 0.0025
Further Details:      
 
Domain Number 4 Region: 8-87
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-19
Family PDZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021791   Gene: ENSSHAG00000018452   Transcript: ENSSHAT00000021966
Sequence length 515
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856995.1:3606560:3621461:-1 gene:ENSSHAG00000018452 transcript:ENSSHAT00000021966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTITPRECKLSKQDGQSYGFFLRIEKDTEGHLVRVVEQGSPAEKAGLRDGDRVLCING
VYVDKEEHLKVVDLVKKSGNSVTFLVLDGVSYEQAIKKGTSLKELSQSHKESPPVMNGVA
GAGSQPRLCYLVKEGSSYGFSLKTVQGKKGVYMTDLIPQGVASKAGVQSEDRLIEVNGEN
VENASHEEVVEKVKKAGSQIMFLLIDKDMDKYYNDHKIKVKRETASLVLLPHKPRVVDMT
KGRDGYGFYLRVGPGQKGQIIKDIDSGSPAEAAGLKNNDLLVAVNGESVENLDHDSIVEK
IKKGGDQTSLLVVDKETDAIYRLAQFSPFLYYLQNQVLPNGTVKEVPAVPSPMAAGPASS
EKVTYKPKLCRLVKGPQGYGFHLNAVRDQPGSFIKEVQKGSPAALAGLEDDDYIIEVNGV
NVMDEPYEGVVEKIQISGKSVVLLVCAKKAYNYFLAKKIPILSSMADPLEDSPNSTEESP
ATPEKDSPVTKERSFPSAQANSTGSQSSSSEDTEL
Download sequence
Identical sequences G3X286
ENSSHAP00000021791 ENSSHAP00000021791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]