SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021890 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021890
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 2 Region: 411-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000486
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 467-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021890   Gene: ENSSHAG00000018529   Transcript: ENSSHAT00000022065
Sequence length 585
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834652.1:3698020:3790570:1 gene:ENSSHAG00000018529 transcript:ENSSHAT00000022065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLASLLLHCLPLAMGDYDICKSWVTTDEGPSWEFYACQPKAMSMKDYVTVKVEPAGIT
CGDPPERFCTHENPYLCSDECDASNPDLAHPPRLMFDKEDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSIELTDDIVVTFEYGRPTIMMLEKSLDNGRTWHPYQYYAEDCMEAFNMPPR
RVRDLSSTSANRVVCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNLDNLYTRLESA
KGLKEFFTATDLRMKLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSYKE
GGLQCECEHNTTGQDCGKCKKNFRTRSWRAGSYLPLPNGSPNACAAAGSAFGREWTSSST
AAPLQMGTPMPKVNTKAEAITTVAVPAKISKLFQLKPRSPQVVPIEVFKDCECYGHSNRC
SYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSINDRCN
ETGHCECREGAAGPKCDDCLPSHYWRQGCFPNVCDDEYLLCQNGGTCYQNQRCLCPSGYQ
GVLCDQPLCQGEEGQACDPAPCASPHLAAFLGSGLLLWLAGCLGY
Download sequence
Identical sequences G3X2I5
ENSSHAP00000021890 ENSSHAP00000021890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]