SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021941 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021941
Domain Number 1 Region: 663-731
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.28e-20
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1574-1633
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.84e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1404-1465
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.15e-16
Family TB module/8-cys domain 0.00017
Further Details:      
 
Domain Number 4 Region: 840-969
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 926-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 6 Region: 1085-1214
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 543-613
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000105
Family TB module/8-cys domain 0.0029
Further Details:      
 
Domain Number 8 Region: 1222-1340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000011
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 611-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000477
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 10 Region: 1472-1523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1732-1777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000263
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 1762-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000569
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 13 Region: 1517-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 14 Region: 1333-1372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021941   Gene: ENSSHAG00000018569   Transcript: ENSSHAT00000022117
Sequence length 1816
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834540.1:3749989:3935199:1 gene:ENSSHAG00000018569 transcript:ENSSHAT00000022117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCPLSSSCPRPIMGSYWRSFLPLTLAFFVGVGDAQRDLVGRYEPSGRDRGRLRRPGVNH
SGATVGKVYSLFRDQGGLGPGQPHGDVPQPVWGHLRNPTDGEIRRPLRTQQTRRVPPPVQ
MSAITLRQQSPPLARTASALQRPRTGQRVRAAPPPPPSSRGRLMGRNVCGGRCCPGWTTA
NSTNQCIKPVCEPPCQNKGSCSRPQQCVCRSGFRGNRCEEVIPEEEYHPQPSWPVPRSPV
RRGVFPNPHCRSRLVGSLLNLIQPLLPCEPTPENANQISHPISPQQQLRSSPTIRRYPGV
VTGQLTSNALTGGNGHEQSDSSHRAIHVAPGSSPWGLNLTEKIRKIKIVFTPTICKQTCS
NGRCINDCSKGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGK
FCHLPALQVNRKPERPPPVAPAEGSLKQSVYMLPLSNQLASVNPSLVKVHINHPPEATVQ
IHQVARVRGETEPHEENSVETRPAPRLPIRPGHEQWDINTITSQTREPPQLPPPSFPKPE
GLLGWCYQNSVNDQCANPLRELTKQEDCCGSVGAFWGVNACSPCPPRPEYSPASPVIENG
QVECPQGYKRLNHTHCQDINECLLLGLCKDAECVNTRGSYLCTCKPGNMLDPSRSHCVSD
KAVSMEQGLCFRSAGTGTCTLPLAQRITKQICCCSRVGKGWGKKCEKCPLPGSESFREIC
PAGHGYTYSSSDIRLSMRKAEEEELARSLEKPGERNNGTLIWTAGRQPLREVTASQSEAV
ATSAKGDSDGGQITATVDSMPAGSLAPAIETPSPPLFGQVTPDPREEEKDTSLPSVASTL
NKDNDRCATLAEDVCGPGTCVNLPGKYSCVCNPGYQLHPSQAYCTDENECLRDPCKGKGR
CINRVGSYSCFCYPGYVLITSAATQECQDVDECEQPGVCIGGQCTNTDGSYHCECGQGYI
MIRKGHCEDIDECRHPSTCPEGSCVNSPGSYTCLACEEGYRSQSGRCVDEDECLALGICL
HGKCINLEGSFRCSCELGFQATEDGKGCNGMELLSTPLLMNKHQSGGKKIQSRDLSFGKL
KEGTVCEDVDECASPGVCLSGICSNTIGSFSCNDCDRGYQPDALGRMCEDVNECEDPQVN
CIGGECKNTLGSYQCHCPLGFQLINGTMCDDLDECAGEEECAPHGECLNTHGSFFCVCAP
GFSSEPGGTSCQDVDECADIARCLGGQCLNTEGSFICVCEGGFRSSPENGECIDVDECKD
FGDTVCGTWRCENSPGSYRCIMGCQPGFHMTPTEDCIDIDECANETLCGNHGFCDNTDGS
FRCLCDRGYEVSPSGWDCVDVNECELMVAVCGAALCENVEGSFLCLCADDHEEYDAQDGR
CRQRTVAGQESMKELTGENFPGPERKFCYSGPSNQSPCTSILGRNTTREECCCTQGASWG
DSCDPCPFPGTVEFSELCPSGKGYIPVEDTWMFGQTTYTDADECLMFGSELCHNGQCLNT
VPGYICLCNPGYRYDASHMECEDHDECQDTACENGECVNTDGSFHCFCSPPLVLDPSQRH
CVNSTGSMADLPDHDIHMDICWKKVTNYVCSQPFRGRRTTYTECCCQDGEAWSQQCALCP
PRNSEVFAQLCNVARIEAEREAGLHPRPGYEYGPGPDDLHYGLYGPEGAPFYNYLGPEEG
ASESPFLHPGSGPVPNLPALEPPLQPSEVQPHFLGNRPGNYDSFEGLRAEECGILNGCEN
GRCVRVDEGYTCDCFEGFQLNIAQMACVDINECENMHGLIAPCAHGHCENTEGSYYCQCP
VGYVAMAGPPRCIPKE
Download sequence
Identical sequences G3X2N6
ENSSHAP00000021941 ENSSHAP00000021941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]