SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021959 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021959
Domain Number 1 Region: 375-533,613-744
Classification Level Classification E-value
Superfamily L domain-like 5.76e-55
Family Ngr ectodomain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 1013-1202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-44
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 143-349
Classification Level Classification E-value
Superfamily L domain-like 4.68e-43
Family Ngr ectodomain-like 0.00035
Further Details:      
 
Domain Number 4 Region: 1-108
Classification Level Classification E-value
Superfamily L domain-like 1.22e-27
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 5 Region: 785-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.006
Further Details:      
 
Domain Number 6 Region: 868-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 7 Region: 909-1027
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000121
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 827-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1284-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000719
Family EGF-type module 0.029
Further Details:      
 
Domain Number 10 Region: 1242-1277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000963
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021959   Gene: ENSSHAG00000018586   Transcript: ENSSHAT00000022135
Sequence length 1397
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834452.1:3778400:3852736:1 gene:ENSSHAG00000018586 transcript:ENSSHAT00000022135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEDGAFRALRGLEVLTLNNNNITTIPV
SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCSGPASLRSLNVAEVQK
SEFSCSGQGEATRSPVCTLSLGSCPPMCACSNGIVDCRGKGLTAIPANLPETMTEIRLEL
NGIKSIPPGAFSPYRKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFG
GLYTLQLLLLNANKINCIRADAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQ
NPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQIKSKKFRCSAKEQYFLPGT
EDYRLNSECNSDAVCPHKCRCESNVVECSNLKLTKIPERIPQSTAELRLNNNEISILEAT
GIFKKLPHLKKINLSNNKVSEIEDGAFEGAASVSELHLTVNQLESIRSGMFRGLDGLRTL
MLRNNRISCIHNDSFTGLRNVRLLSLYDNQISTISPGAFDTLQSLSTLNLLANPFNCNCQ
LAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGQEEGGCFPRPQCPQEC
TCLDTVVRCSNKHLRGLPKGIPKNVTELYLDGNQFTLVPAQLSTFKYLQLVDLSNNKIGS
LSNSSFTNMSQLTTLILSYNSLQCIPPLAFEGLRSLRLLSLHGNDISTLREGIFTDVTSL
SHLAIGANPLYCNCHLRWLSSWVKTGYKEPGIARCAGPPDMEGKLLLTTPAKKFECQGPP
SITVQAKCNPCLSNPCQNQGTCQNDPLDSYRCTCPSGYKGRDCEMSLNSCSSGPCENGGT
CHSSQAGEGSGFTCSCPVGFEGPTCGVNTDNCRDHACENGGICVDGINNYTCLCPFQYTG
RVCEQLVDFCSLNLNPCQHGAKCVGTPEGPKCECTPGYVGDNCSINYNDCIDHQCQNGAH
CVDEVNGYSCLCEEGYSGQLCEMASQPPKPLSPCEGTECQNGANCVDLGNRPVCQCLPGF
GGPECEKLLSVNFVDKDTYLQFTDLQNWPRANITLQVATAEDNGILLYNGDNDHIAVELY
QGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNFGKHY
TLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMQPGVVP
GCEPCRKLYCLHGICQPNAAHGPVCHCEPGWGGPHCDQQVGNPCQGHKCVHGTCLPLDAL
SYSCQCQDGYTGALCNQPGEPPDPCENLHCLHGHCQISTEGAAHCVCDSGFAGELCEQES
KCQGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCTGLRMKRRRFTFECSDGSS
FVEEVEKAIKCGCARCL
Download sequence
Identical sequences G3X2Q4
ENSSHAP00000021959 ENSSHAP00000021959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]