SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022021 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022021
Domain Number 1 Region: 867-1136
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.75e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 600-865
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.75e-54
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 506-579
Classification Level Classification E-value
Superfamily Chromo domain-like 2.02e-17
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 4 Region: 365-415,443-486
Classification Level Classification E-value
Superfamily Chromo domain-like 6.59e-17
Family Chromo domain 0.021
Further Details:      
 
Domain Number 5 Region: 251-324
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-16
Family PHD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022021   Gene: ENSSHAG00000018641   Transcript: ENSSHAT00000022197
Sequence length 1828
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849764.1:3862901:3933835:-1 gene:ENSSHAG00000018641 transcript:ENSSHAT00000022197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSNDELSDNDEEMEEKSDSEGSDYSPNKKKKKKLKEKKEKKSKRKKKDEEDDDNEDGGL
KEPKSSGQLMEEWGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVL
GAKWREFSANNPFKGSSAAAAAAAVAAVPSAVEPVTIAPPLTVSPPQPIQPMPIRKAKTK
EGKGPGVRKKIKGSKDGKKKGKGKKMAGLKFRFGGMANKRKKGSSSEEEDREESDFDSAS
INSSSMRSECSSALGKKGKRRRKKKRIEDGDGYETDHQDYCEVCQQGGEIILCDTCPRAY
HLVCLDPEMEKAPEGKWSCPHCEKEGIQWEPKDDDEEDEEGGEEEEDDHMEFCRVCKDGG
ELLCCDTCPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWKWTEPPAPFIT
VLPPPDADPSIPLPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKN
DMDEPPPFDYGSGDEEGKSEKRKNKDPHYAKMEERFYRYGIKPEWMMIHRILNHSFDKKG
DVHYLIKWKDLPYDQCTWEIDDIDIPYYENLKQGYWNHRELMLGEDSRPPKRLNKKGKKL
KDDKLEKPPETPLVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADE
MGLGKTVQTIVYLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKES
RSVIRENEFSFEDNAIRSGKKVFRMKKEAQIKFHVLLTSYELITIDQAILGSIEWACLVV
DEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLE
EFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTR
NFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKL
MLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRF
NAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIY
RFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVE
GMMPQGQRINVPEPVAPAPDVQASKGGGTLAAGVKKKHGSTPPGDNKDVEDSSVIHYDDA
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYW
EKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDED
EDFEERPEGQSEGMRVTWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGAD
GAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPESKKSSEIVS
SDPNTPVPASPAHIPPGPLGLPDKMEAQLGFLDEKEQMEPKPPKPPELQVPRMPSDKGDG
EDKQENLENKERSREERREEKEKRDPSPDRLLKEDVLPEKEKALEKVELNMNHGRGDDRD
FRPEDSKVEEKEMVETQQNGEKEEDEDGKKDDKNGKFKFMFNIADGGFTGIKAFWASALR
AQARALRVLCRSSDALWSPCSLARHGYARWQDIQNDPRYVILNEPFKSEIHKGNYLEMKN
KFLARRFKLLEQALVIEEQLRRAAYLNMTQAHNHPAMALNARLAEVECLAESHQHLSKES
LAGNKPANAVLHKVLNQLEELLSDMKADVPRXTLSRLTNRAGDPTVQQGSFGSSQMYNNN
FGPNFRAPGPGGIVNYSQMPLGPYVTGR
Download sequence
Identical sequences G3X2W6
ENSSHAP00000022021 ENSSHAP00000022021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]