SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022031 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022031
Domain Number 1 Region: 1682-1786
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-29
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1321-1424
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-28
Family PDZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 102-214
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-26
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 1566-1667
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-24
Family PDZ domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1103-1202
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-24
Family PDZ domain 0.033
Further Details:      
 
Domain Number 6 Region: 233-333
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-24
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 7 Region: 931-1042
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family PDZ domain 0.00031
Further Details:      
 
Domain Number 8 Region: 1427-1517
Classification Level Classification E-value
Superfamily PDZ domain-like 8.54e-22
Family PDZ domain 0.003
Further Details:      
 
Domain Number 9 Region: 5-96
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-19
Family PDZ domain 0.014
Further Details:      
 
Domain Number 10 Region: 557-653
Classification Level Classification E-value
Superfamily PDZ domain-like 2.93e-19
Family PDZ domain 0.017
Further Details:      
 
Domain Number 11 Region: 449-519
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000355
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022031   Gene: ENSSHAG00000018648   Transcript: ENSSHAT00000022207
Sequence length 1787
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856736.1:3873697:4192986:-1 gene:ENSSHAG00000018648 transcript:ENSSHAT00000022207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGRQIEYIDIAKPSTGGLGFSVVTVRKPNAAGVDLFVKEVQPGSIADRDQRLKENDQI
LAINYTLLDRNMTHQQAISLLQQCTGSLRLVVARGSRQWPSPSSTNLSDTPPPPPPPEKI
CWGHIEDVELINDGSGLGFGIVGGKSSGVVVKTIVPGGLAHRNGKLQTGDYILKIGNTNV
QGMSSEQVAQVLRNCGNFVRMVVARDPIGEISVTPPTPTTLPVVALPSVPTCNQSSVNAS
LFDTYNVELTKKDGQSLGITIIGYAGSSHTGDVSGIYVKNIIPGSAADHSGQIHINDRIV
AVDGVDIQGFANQEVIEVLRRAGDTVHLTLVRTKASSSPLPPDRSIDEASPKTPALFLTG
AVETETNLDEEDEVKQEKKAAQLKDEEKPKLSSQPLDTVPGSLENELKSKWENLLGPDYE
VMVVILDTQIIDDAELQKFSKLLPIHTLRLGVELDSFNGHHYISSIMPDGPVAPLNVLKL
EDELLEVNGVQLTGKSRREAVSFLKEVPPPFTLVCCRRLFDEETFGDEASVTDVVITEPK
VDPNEEVQINDDEDDGELALWSTEVKTIELIKGVDGLGFSILDYQDPLDPTRTVIVIRSL
VANSEAERGRELLPGDRLVFVNDRSLEDITLTEAVEVLKSLPPGRVTLGICKPLVVEGNE
ENACISQPTAFQETPDYSGPMEAMDSPLILEAPSEFRDDSFLREEDLEEPFIDLGRTFHG
QSKEIDSTQEAWEMHAFLKPRAPEMGEEREMLVDDVYDFQDIFQNMDLYSSTLGKKDHPL
SAGQDFHFGTQWLSHPAAYEAHDLRSMVHPTSQELAQNRYNSEAMINENFGNASLSVITS
SEGDMCQGIFGDLNNSESITNSGLDLGRRMASASEGPEMLVDLPAVVQGSKGEDVPVYRL
PHKRGLLKTGVLPSKYAAETCDLPEREEGEGEETPNFSHWGPPRIVEIVREAHESLGISI
VGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQNATHQEAVE
AIKSAGNPVVFVVQSLSSTPRVIPPLTSKTSHPPKTQHREKEDRKEKRRGGAPPPMKLPP
PYRAPAEDSDHDDDDQTELTEEKIRQRYADLPGELHIIELEKEKNGLGLSLAGNKDRSRM
SIFIVGIHPDGPAGRDGRMHIGDELLEINNQILYGRSHQNASAIIKTAPTKVKLVFIRNE
DAVNQMAVTPFPFPVSSQSSIEDQSGPEAISNEEETNTEVDLKQLLPESDRIQLDEAPQI
VDHILAADEAKGGEPLPDTTAGQVKQPKYSTKKPIGSEEISLAPSSSYCSTDMEFAGYGV
LQIPLSVDPATCPIVPGQEMIIEISKGHSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARD
GRLWAGDQILEVNGIDLRNASHEEAITALRKTPQKVQLVVYRDEAHYKDEENLEIFPVDL
QKKTGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRSASQETV
ATVLKCAQGLVQLEIGRLKAGSWFSSRKTSQNSQTGLSSVRNSFPPSLAPVITSLQNLVS
TKRTSDSSQRNSAGADVGPRTVEIIRELNDALGISIAGGKGSPLGDIPIFIAMIQASGVA
ARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRIILQVVADTNINAIATQLESMS
ASYYLGSLDGDHHPEDPETPQPKMIALEKGTDGLGFSIVGGYGSPHGDLPIYVKTIFAKG
AAADDGRLKRGDQILAVNGEALEGVTHEQAVAILKRQRGTVTLTVLS
Download sequence
Identical sequences G3X2X6
ENSSHAP00000022031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]