SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022384 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022384
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-26
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022384   Gene: ENSSHAG00000018947   Transcript: ENSSHAT00000022562
Sequence length 130
Comment pep:novel scaffold:DEVIL7.0:GL834541.1:5056173:5087606:-1 gene:ENSSHAG00000018947 transcript:ENSSHAT00000022562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNQLRLGFNIVGGTDQQYVSNDTGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKN
LLHQDAVDLFRNAGYAVSLKVQHRVQVQNGPLGHRGEGEPSGIPVAMMLVPLCAVAMAVA
WAIMRYRQRL
Download sequence
Identical sequences G5EA67
ENSSHAP00000022384 ENSSHAP00000022384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]