SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000336 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000336
Domain Number 1 Region: 56-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-27
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 2 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 656-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 712-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 754-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 315-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000107
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 11 Region: 268-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 12 Region: 451-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000451
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000336   Gene: ENSSHAG00000000297   Transcript: ENSSHAT00000000341
Sequence length 813
Comment pep:novel scaffold:DEVIL7.0:GL853029.1:359:16187:1 gene:ENSSHAG00000000297 transcript:ENSSHAT00000000341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEQEPTSGFRATRSQTKEKKKTRGKKAEQPVNTMRKSENMNNSQQPWASHLCRRASVT
FKDVAVDFTQEEWGQLDPSQRSLYRDVMLENYENLVSLGLPVSKPDVISQLERGKVPWMQ
DGEFLRGICSDSYIQETTSETKDFTPKQRIYIRVPSQGRLKKDDPKMEKTWEYDVRLERK
KSNQKKQSRQVTTAPKNLAKQRHFVESNADGRKFTLGSVFVPKQNVPLGKNHQNYGSQGN
SIKPISDLVKHSKISKGKTLSKYNCKKSFTYHSDFVQFHMVHSGDKPCKCNECEKAFSKS
SHLAEDERIHPGKKNECKKELSHSGSLSQNKRANIGEKPFKCHYCGKAFNNNSSLVLHLR
IHTGEKPFECNVCGKAFSQRGNLNEHKKIHTGEKPFKCNECGKAFSSNSSLTLHQRVHTG
EKPFKCSECGKAFSQRGNLNEHKRTHTGEKPFECNECGKAFSQRGHLTEHQRIHSGEKHF
ECSECGKAFNHRVSLIDHQRIHTGEKPFECNECGKAFNQRGHLNEHKRIHTGEKPFECNE
CGKAFIHKGSLTEHQRIHAGEKPLECNECGKTFSHRTSLYSHLRIHTGEKPFECNDCGKA
FSHNASLIYHQRIHTGEKPFECNECGKTFSHRRSLLHHQRVHTGEKPFQCNECGKAFSQR
GNLFYHQRIHTGEKPFECNECGKAFSHSTSLIYHHRVHTGEKPFECSECGKAFSQRGQLN
KHQRIHTGEKPCKCNECGKTFSQTGHLLRHQRVHTGEKPFACNKCGKSFSQRGSLVLHQR
IHTREKPFQCSVCSKAFSHRTSLICHQRVHNGK
Download sequence
Identical sequences G3VAY2
ENSSHAP00000000336 ENSSHAP00000000336 XP_012402834.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]