SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000507 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000507
Domain Number 1 Region: 433-500
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000451
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 2 Region: 588-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000863
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 271-367
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000149
Family TB module/8-cys domain 0.00077
Further Details:      
 
Domain Number 4 Region: 790-842
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000196
Family TB module/8-cys domain 0.00083
Further Details:      
 
Domain Number 5 Region: 231-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000415
Family EGF-type module 0.00091
Further Details:      
 
Domain Number 6 Region: 502-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 721-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 123-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000451
Family EGF-type module 0.027
Further Details:      
 
Domain Number 9 Region: 4-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 10 Region: 192-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000507   Gene: ENSSHAG00000000453   Transcript: ENSSHAT00000000515
Sequence length 845
Comment pep:known_by_projection scaffold:DEVIL7.0:GL842951.1:1070:68878:-1 gene:ENSSHAG00000000453 transcript:ENSSHAT00000000515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEECENNPGICDSGHCTNIPSECLCYDDFMASMDMKTCIDLDECHLNSNICMFEECENTK
GSFICCCQLCCSGKRENIEYTDIDECDIDVHNCNRHASCLNIQGSFKCSYREGYSIGCVK
LDECSAGTHQCSINAQCVNTPGLNHCACFEGVTGDGFTCLVDDDCAENFNLCENGQCLNI
PSTFTPGSGSKFCQDIDECSFQNIRVFGTCKNLPTMFHSICDDVYELDRTEDNCTDVDEC
VNPTNCVNGFCVNIPGRFECNCPPDFQLNPTGTDCVDNQVGNYYLKFGPPCNTEIGVGVS
HSSCSCSLGKTWGNSCESCPPVNSNEYYNFCPGVESFRPNPVTIVFEDIDECQELPGLCQ
GGNCINTFGSFQCVCPHGYYLSEELPSSKKFSYKELPIPPGVCRPDTYYNTLGNYTCIGP
PEYMQINGGHNCMVIDMRKSFCYQNKTTCENELPFNVAKRMCCCTYNFGKAWNKPCEPCP
TSGTVEFKAICGNLPGFTFDIHTGKVIDIDECKEIPAFFANNVCANQIGNFHCECPTGFN
YNDLLLVCEDIEQHKFGPIPICICIYMHICVYCVCVCTSYIPVLNFVLDRNECLEMPNVC
SHDLRVDLQGSYQCVCHSGFKTSQDQTMCMGIDECEDHLCGNEICKNTVGSHNCLCYPGF
ELTHNDDNLDIDECSSFFGQVCRNGQYFNEISSFKCLCNEGYELTPDGKNCIDTNGYVTF
LGSCSPGACQNPEGSFRCICPSDYEVKSENSIDISECNEDPNICLFGSYTNSLGGFQCVC
PTGFILFDKGQRCFDTCQSFCFKNFENGMCTVAKAFNTTKTKCCCSKMPGEGWGNPYEMY
PKDDE
Download sequence
Identical sequences G3VBF3
ENSSHAP00000000507 ENSSHAP00000000507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]