SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000884 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000884
Domain Number 1 Region: 611-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-42
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-19
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 3 Region: 327-393
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-17
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 4 Region: 409-469
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000641
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Domain Number 5 Region: 85-135
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000153
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000884   Gene: ENSSHAG00000000790   Transcript: ENSSHAT00000000895
Sequence length 789
Comment pep:novel scaffold:DEVIL7.0:GL864935.1:3600:27189:-1 gene:ENSSHAG00000000790 transcript:ENSSHAT00000000895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIESFKTELTCSICLGYFTDPVTAKCSHSFCRECLLQCMRGAGDTLPCPECRQLIQISNL
VSNLNLQKLSMAGKTIGVPLLQSIVTLTTCEQHWEKEKFFCEEDQKLLCESCSITQEHKD
HRILPLHSVIAEGKQDQLQETKNVLGNGIKSSSKITSLLLEKNLFIQNQPHPERQHWEMN
YSYLSDKILSWESHSLPLLKEKEKRKVELVQRRRKEVIRQDEKCQTLFPNLDLFLQGKKI
QSLLESDLSKYQSSFTHVALPQARSTKSHRLAGRPMLKYMLNAKYNMYTVTNLWVIYGES
LEGKRRRNILGNRGPQGVNQVNSHLLENVKEELTCSVCMDYFRHPVTLNCGHSFSHICLL
QSWGENDRPCPCPLCRRPFHMRDIELNHCLGKLAIIGKTLRPYLLQLKEEKVKCEKHQEE
KTLFCEKDTFFLCVYCFQSQEHQGHTVHSIKEAAEDSRIKLQKTLDLLWKKVTTVQNVMT
EEREKEKTWKEKIQVWRESLTAEYRPFSELLEKEAQLLFHIMNKQERDNLKNIRETQIRL
SQQLHSLREVILDMEQDSWKTSSQFLKFYSGILEFSRFWPITSPLLYFLKARNIFLTPPK
GLVTIAGMLLMQFFYVTLTLDPQNISPFLILSDDLRTVIHGSNQQNIGFPTNHYENNFIW
GAQVFTAGIHYWEVEIGDSREWAVGVFQTSMRRNDGLFFHFDELLLLSSVRTEDRYTIMT
IPSYFEHLIPFPIRRVGILLDCDEETVSFYDALADCFIYRFPPFSFSGPMQPLFSPSPPT
GKRMAPPMT
Download sequence
Identical sequences G3VCI0
ENSSHAP00000000884 ENSSHAP00000000884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]