SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001074 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001074
Domain Number 1 Region: 107-132,210-270
Classification Level Classification E-value
Superfamily SET domain 0.00000068
Family Histone lysine methyltransferases 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001074   Gene: ENSSHAG00000000962   Transcript: ENSSHAT00000001088
Sequence length 274
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841162.1:5219:25563:1 gene:ENSSHAG00000000962 transcript:ENSSHAT00000001088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGKETRTLRYVPENCRDKIIPDEDVLATLLKVFQALFVSDFNRQTDILVLLPETIKSKYR
DLLITHHQRTELPRCNIQQQNIYKPGEVLFNTLGFSISRETSSLISAGKGVFVTKGFVPK
GAVVSMYPGTVYQKHEPIFFQSIGNPFIFRCLDGMLIDGNDKGISKVVYRFRSCNGRDQL
GPFKMSDSTWLTSEIQNPLAVGQYVNNCSNDKEANVCYQEFDVPELFPLEFKQYLPNIMY
SCDIQSPLRCVVLVALRDIQQGEELFSNYYTIIN
Download sequence
Identical sequences G3VD20
ENSSHAP00000001074 ENSSHAP00000001074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]