SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001450 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001450
Domain Number 1 Region: 237-350
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000542
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001450   Gene: ENSSHAG00000001291   Transcript: ENSSHAT00000001466
Sequence length 366
Comment pep:novel scaffold:DEVIL7.0:GL856757.1:14299:17410:1 gene:ENSSHAG00000001291 transcript:ENSSHAT00000001466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNDKQKDTYLSLLLVLKATHLQEGSSVLILCNMNIKSLMNLSVWHPKQSTTRREILSRMQ
KVALFKIQSYWLPNFYIHCKINMAKEEECQALLQEYEERLASISSDLPLKMSIRRLYVTR
KPYCSKKIKKKMWRFIEQGTWTVESELPLIHTLHPPKSKFPPPKLVVHVGALRPLRPLRF
KDSLDNLKVKESITSTIFSSKVDTKTFRPFSLEGVCEKKFTAKLRNSTPVINYPSRLSLK
KVIKKSCSFEYLHWALTADSYAGNPFGDYLKSKHYKMENRLLRFWKDLDNFLTICISAKK
GGNLLFRHTLGNRICELYLSEDNGSTLPLKPQTIQHLKQLLPSGNAIPWIPTAQKEICKV
SCSAMK
Download sequence
Identical sequences G3VE46
ENSSHAP00000001450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]