SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001939 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001939
Domain Number 1 Region: 43-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-33
Family SCAN domain 0.00015
Further Details:      
 
Domain Number 2 Region: 611-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 220-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 740-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 806-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-17
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 653-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 971-1022
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 843-900
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000177
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 391-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000139
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 888-945
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000171
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001939   Gene: ENSSHAG00000001725   Transcript: ENSSHAT00000001960
Sequence length 1028
Comment pep:novel scaffold:DEVIL7.0:GL842191.1:16411:48669:1 gene:ENSSHAG00000001725 transcript:ENSSHAT00000001960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMIARGGKALFKTTLGSGKHVLMKNKDDNLGQKSHLQKNVSSGQELFRQLFRQLRYQDT
SGPQEALVRLQELSRWWLRPDIHTKEEILERLVLEQFLTILPGDLRTWVLLHHPENGKEA
VALVKDLESHFSDQEREVSDQAQVQDVLWMGTTSLGAAQESHPIPSLRSYSSHRTYLDSD
YDTGMFHLQDPPNVPPTPQIPAVPQEESTGQMMAMSPEAKSQDSVTFEDIAIYFSKAEWP
HLSPAQRALYKKVMLENYRNLASLVRPFPKPAVISKLEEVSWDLQETPDQVDLKNTHAGG
EPHNEVKKLVEKQEIGKEDSQALSQTQGGLQTSIPEQPHFEEFNEHKNRKEKQGGKSALE
IKRVERDSKYMADRDVTTAEETEENYQRHLSSNLVSHQKIPQIEKVYKCDECGKYLKHSS
DFVQHQKTHSGEESSKYDEVGKAFSHTSELGQVQRIKGKDMPYKCKDCDKSFSHRSHLDH
HQRLHTRERPYKCKECGKAFRWSSNFARHRRIHTGPKLYECQECGKGFTRISQYIIHQRG
HFGKKHYITNRYNRTFRHISAFNKHRKVHTGEKCYNCKDCGKTFTRNRTLLDHQKIHTGE
KPYRCKECGKTFTRNRTLLDHQRIHTGEKPYRCKDCGKTFTRNRSLVEHERIHTGERPYE
CIKCGKAFNRKSYLFLHERTHNQKKPYKCNICGKDFRWGSGFSRHRRSHIENHDEGNDQR
RIFNHRSDIQHQNTEHTEKKSYQCHECGKTFTRKRTLIDHQRIHTGEKPYKCSHCGKAFS
CKPYLIVHQRTHIFKAHQKNCITKNCYDCTQCGKTFSQKSSLIVHQRLHTGELPYKCSVC
GKAFRWKSNFTQHQRSHIGMKQFKCQECGKIFSQKDRLIDHQTIHSEEKVFQDQQGDKTF
NQKFTEYQQVADHEKPYKCNQCGQSFSCASGLSIHQKIHTEEKSYENDNMETSFQDSSPT
SHQKFHIREGVYKCNICEKAFPKKSQLLMHDRFHTRERPYSCKKCGKKFRWSSNLSRHQK
KHATCLLD
Download sequence
Identical sequences G3VFI5
ENSSHAP00000001939 ENSSHAP00000001939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]