SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002093 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002093
Domain Number 1 Region: 61-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000002
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 410-711
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000897
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002093   Gene: ENSSHAG00000001861   Transcript: ENSSHAT00000002116
Sequence length 726
Comment pep:novel scaffold:DEVIL7.0:GL841657.1:18716:44848:-1 gene:ENSSHAG00000001861 transcript:ENSSHAT00000002116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVLVLLKTAVFQNTKDSQCRRRGCPQNAICINKTHCACEDGFVTTSGEKYFSDFLEICD
DVNECVPPIKIFCGMNADCVNTYGSYHCTCIPGYALPSGEKNFPNASMNNCQGKKTCSFP
PHTGLNNFLLTEPMPGRTLHFRENITKAEEQNSKFNTVLSRCLFPSPGVPPPIMSSHLHM
FVQYVQKTFFVSKSLLIKSILFLFFSIERSHQNQPSSLSVLLTFQHIQNSSLLKIVEEII
FMNVRFFFTSLMSFHAPHVRIFLLIQEKGWEMLTIFQKHQNLKLRSHVQAQKCLIKDLLV
SIYLIQNNEYLLEGSGGMKGEKKNKIKKVHSREIKGCKRRGKKKMNSLLFLKSIIDPCLH
PSLHTFHLCRSQKKKEEERSLCVYWEAQGEEGGAWSTKNCNLIESNKTHTRCNCTHLSSF
AVLMDLQQQDEDYVLTVITYVGLSLSLLCLFLAILTFLLCHTIQNTSTSLHLQLSLCLFL
ANLLFLIGIKQTKIKVLCSIIAGLLHYFYLASFTWLLLEGLHLFLTARNLMVANYSRVNH
SLRKVMYPLGYGIPAVIVAISAASRANLYGTSSQCWLQTQEGFLWAFLGPVCIIFSINFV
FILLIIWILQSKLSSLNNEVSTLQDRRLLRFKALTQLCILGCTWCLGILQIGPAARIMRY
LFTIINSLQGVFIFLVYCLLNHQVQEQYKKWFKTLRPTKSESFMLSSKVVSGSTQNHTVR
KTTAFL
Download sequence
Identical sequences G3VFY9
ENSSHAP00000002093 ENSSHAP00000002093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]