SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002179 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002179
Domain Number 1 Region: 127-313
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.33e-20
Family Hypothetical protein TM0207 0.077
Further Details:      
 
Domain Number 2 Region: 22-122
Classification Level Classification E-value
Superfamily ISP domain 0.00000000000017
Family Rieske iron-sulfur protein (ISP) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002179   Gene: ENSSHAG00000001939   Transcript: ENSSHAT00000002203
Sequence length 577
Comment pep:novel scaffold:DEVIL7.0:GL841341.1:20506:100955:1 gene:ENSSHAG00000001939 transcript:ENSSHAT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKNQVAEILLSLSPLEVVGLKEGINFFRNKKSGKNYILYKDKNHLRACKNMCKHQGGL
FIEDIEDLDGRSVRCTKHNWKLDVSTMKYINPPDSFCQDELVIEMDENNGLLLMELNPPN
PWEADPHPPEDLAFGEVQITYLTHACMDLKLGEKKMIFDPWLTGPAFARGWWLLHEPPLD
WLERLCQADLIYISHMHSDHLSYPTLKKLADRRPDIPIYVGNTERPVFWNLRQSGVPLTN
IHVVPFGTWQEVDQNLRFMILMDGIHPELDTCIIVEYKGHKILNTVDCTRPNGGRLPEKV
DLMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKAQLVKDLQPRIFCPFAG
YFVESHPSDKYIKETNIKNDPNDLNNLIKKISNVSTWTPQPGAVLDLGRMLKDPTNSKSI
INPPAGTKIYKDSWNFEPYLQTLNYAIEDEIFLHPSWIKEYFTWAGFKNYNLVIRMIETD
EDFNTLPTGYNYLVDFLDLSFPIERPSRDHPYEEIRSRVSVIRHVVKHGLLWDDLYIGFQ
TRLQRDPDIYHHLFWNHFQIKLPLTPPNWKSFLMQQR
Download sequence
Identical sequences G3VG75
ENSSHAP00000002179 ENSSHAP00000002179 XP_003760174.1.9362 XP_012397058.1.9362 XP_012397059.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]