SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002196 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002196
Domain Number 1 Region: 96-493
Classification Level Classification E-value
Superfamily Serpins 1.44e-120
Family Serpins 0.00000000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002196   Gene: ENSSHAG00000001952   Transcript: ENSSHAT00000002220
Sequence length 496
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841921.1:20702:29276:1 gene:ENSSHAG00000001952 transcript:ENSSHAT00000002220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGLQLFLLSLVTSPVFGRREEPGGLVENGEGSPPAKGQWAPLDLGNLSLPADFHRENT
VTHDLLVEEEEEEDYLDLEKIFSEDDDYIDIIDAVAPPDPEAQPGNVLELFQGKSRIQRL
NILNAKFAFNLYRTLREAAGPGDNILLAPVGISTAMGMISLGLKGATHEQVHAAAFFRDF
VNASSKYETQTVHNLFRKLTHRLFRRNFGYTLRSVNDLYVQQRAPVLEDFQNKVREFYFA
EARPAAFSEPAFIAKANHHILKVTKGLIKDALVNVDPATQMMILNCIYFKESTGTWVNKF
PVEMTHNSNFRLNEREVVKVPMMQTKGNFLVANDQELDCDVLQLQYVGDISMLIVMPHKL
AGMRTLESQLSPQVVERWQKSMTNRTREVRLPRFKLEKNYNLVDALKAMGITALFDHTGD
FSGISDQKLAIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQVRFIVDRPFLFLIYEHR
TSCLLFMGRVSNPSRS
Download sequence
Identical sequences G3VG92
ENSSHAP00000002196 ENSSHAP00000002196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]