SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002519 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002519
Domain Number 1 Region: 664-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-25
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-25
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 496-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-25
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-24
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 8 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-24
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 54-111
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 11 Region: 705-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 167-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002519   Gene: ENSSHAG00000002231   Transcript: ENSSHAT00000002547
Sequence length 766
Comment pep:novel scaffold:DEVIL7.0:GL861537.1:26468:42308:1 gene:ENSSHAG00000002231 transcript:ENSSHAT00000002547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPESQRPLPQIHLADGYSVTCPQLNQEEKLFVGRRFSALFQGITQSVFSQNLELVTFRD
VAVDFTREEWGLLDRAQKELYKEVMLENAQNLLSLGLPVPREEVISYLEQREAPWMLEQE
DLRTGCPETEIKLEMKEATAELHLSLEETHKHKFMSDGSYDFTWREIYDQNIHVGEKPYE
CNHYGKAFRQQSSLIYDQKIHTGEKPYECHECGKAFSEPSSLIIHQRIHTGKKSYECDQC
GKTFRFRNDIAVHQRIHTGEKPYECDQCGKAFTQKGGLTVHQRTHTGEKRYECNQCGKTF
RCSSSLPVHQRIHTGEKLYECNQCGKAFTQKGGLTVHQRTHTGEKRYECNQCGKTFRYSS
SLPVHQRVHTGEKPYECNQCGKGFRSSSSLTQHWRIHTGEKPYECNQCGKTFIKRASLTL
HGRIHTGEKPYECNQCGKTFGCSTRLVLHERIHTGEKPYECNQCGKAFTQRASLALHERI
HTGEKPYKCYQCGKGFRSSTNLAVHQRIHTGEKPYQCNQCGKTFTERSSFTVHQRTHTKE
KPYKCDQCGKAFTQRASLDHHQRIHTGEKPYECNQCEKTFRYSSSLTVHQRIHTGEKRYE
CNQCGKTFTERSSFIVHQRTHTGEKPFACNQCGKTFRTRSGLAVHQRNHTGEKPYKCNQC
GKAYPQRASLDHHQRIHTGEKPYECNQCGKTFTCRSSLTVHQRIHTGEKPYKCNQCGKTF
RCSSSLPVHQRIHNGEKPYECNQCRKTFTQRAGLTVHQRIHTGEKP
Download sequence
Identical sequences G3VH65
ENSSHAP00000002519 ENSSHAP00000002519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]