SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002614 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002614
Domain Number 1 Region: 131-191
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 707-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 651-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.56e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 749-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-20
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 10 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002614   Gene: ENSSHAG00000002312   Transcript: ENSSHAT00000002642
Sequence length 808
Comment pep:novel scaffold:DEVIL7.0:GL850258.1:28411:47806:-1 gene:ENSSHAG00000002312 transcript:ENSSHAT00000002642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPLNSHVLGPQEPVGLLSLKVMDDVPGGEEFVPGEDLDTDYDAFCRGLTDDLGDPHER
AEQFLTIMLGNVETWMKLQHLEPSEEVLIVEDSPTQLLERRELLCRDPAFHEEWNPEKEV
EEMAAEFLASRSQEPVTFQDVAVDFSQEEWGQLDPAQRDLYRDVMLENYGNLVSLGLVVS
DPSVIYHLEQKKEPWKLDLQGTDKTKVLRGTWPDQNTQTESQAKSSTSKQGTSEEGLLWG
SIMEKSTRDGSLNSKLRIASQCEGKLKRKKKRRNQEKLYECSECRKAFNHFSALIRHQRI
HTGEKPYECGECGKTFSQSTCLTVHQRIHTGEKPYVCGECGKTFSDSSTLIRHRIIHNIE
KPYKCHECEKSFSYCSALIRHLRIHTGEKPYECNECGKSFSHSTCLTQHQRTHTGEKPYE
CSECGKAFSQNSSLYYHQRTHTGEKPYKCSECGKAFSYHASLTQHKQTHTGERPYECREC
GKTFSRSTYIIEHQRIHTGEKPYECTDCGKAFRYCSALTQHQKIHTEEKPYECRECGKGF
HFYSALIQHRKTHTGEKPFECTDCGKAFIRSTCLTQHQKIHTGEKCQENSESKKTFGQSS
SLPENQRVKTGGKSFVCNECGKIFKYYSILAQHQKTHTGEKPYECNECGKTFSRSTCLTK
HNRTHTGEKPYLCSVCGKAFSQNSSLTEHQRIHTGEKPYECSKCGKAFSRSTFLTRHQQT
HTGEKPYECSECGKSFSQRSSLYYHQRTHTGEKPYECFECGKSFSRSTFLTQHQRIHTGE
KPYACSECGNTFSRRAALTKHQKLHTEK
Download sequence
Identical sequences G3VHG0
ENSSHAP00000002614 ENSSHAP00000002614 XP_012402412.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]