SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003176 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003176
Domain Number 1 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 264-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 656-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 44-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 712-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003176   Gene: ENSSHAG00000002804   Transcript: ENSSHAT00000003212
Sequence length 763
Comment pep:novel scaffold:DEVIL7.0:GL861933.1:41979:68085:1 gene:ENSSHAG00000002804 transcript:ENSSHAT00000003212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSGSLRPLPQRYDHLVVWKPHLCLQLPGSLEPEGMCPGSLRPHPQELLTFRDVAVDFTQ
EEWGLLDDPQKELYKEVMLENAWNLFSLGLLVPSAYVISYFNQRKSQWMLDQEGLRSCSP
EREMTLEMKESTPERSLSVVDTHKPRIISDTPGNFTWKDIRDTLEKIHIGEKSSEHNQNG
KDFIERWALTRHKKIHTSLEYNQYVKTFKYKNSFPLHWNVHAGQKPYECNQCGKIFSNKR
TLTVHQRIHTGEKPYECNQCGKAFIGSGNLNRHQRIHTGQKPYKCNQCGKAFTQKESLTR
HQRSHTGEKPYNCNQCGKAFTKKESLTGHQRIHTGEKPYECNQCGKTFTKKQSLTIHQRN
HTGVKPYKCNQCGKAFIESGTLSVHERTHTGEKPYECNQCGKAFSHKGTLTIHQRNHTGE
KPYECNHCGMAFTESRGLNRHQIIHTGEKPYMCNQCGKTFTIKQSLTGHQRIHTGEKPYK
CDQCGKTFTKKESLTGHQRIHTGEKPYECNQCGKAFTKSGALTGHQKIHTGEKPYKCNHC
GKTFTKKGSLTVHQRIHTGEKPYECNQCGKAFSHKGNLTIHQRNHTGEKPYKCNQCGKAF
TESGGLHKHQRIHTGEKPYKCNQCGKTFSHKVTLIIHQRIHTGEKPYKCNECGKGFTKKG
ALTGHGRIHTGEKPYECNQCVKTFTKKESLTVHQRIHTGEKPYECNQCGKIFRQKGALTG
HGRIHTGEKPYECNQCGKAFTKKESLTVHQRIHIGEKPYECNQ
Download sequence
Identical sequences G3VJ21
ENSSHAP00000003176 ENSSHAP00000003176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]