SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003271 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003271
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000369
Further Details:      
 
Domain Number 2 Region: 237-340
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.45e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 399-458
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000235
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003271   Gene: ENSSHAG00000002882   Transcript: ENSSHAT00000003307
Sequence length 469
Comment pep:known_by_projection scaffold:DEVIL7.0:GL867807.1:44508:56716:1 gene:ENSSHAG00000002882 transcript:ENSSHAT00000003307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPRGSGGAPQQQNVPSGLLQDHENQRLFGLLGRKCWTLATSVAQLYLAPPSMGGRWH
KELSGAICFVKDNPRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAG
LNFADETEAQAFRALVEEKIQKRSQKQNAGEKGAKPPPGSLSTERRGGSTPLPSQPSGDL
SASTLGSPSLGLVAVDIQNPDITSSRYRGLPAPTPSPPDKKRSGKKKISKADIGAPSGFK
HVSHVGWDPHSGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRE
EMRRQGKYPHLGPSRAPLKGPRDPLLPQPLESRPVPPPPPPSRAGAPQRSPGSSVAGSRG
GRSGPLPPVPSGTGGIPSVPPPVPXSWGGSAAAAPAPRGRGALLEEIRQGIQLNKTPGAQ
EIPAPPPPSSEGLVGALMHVMQKRSKVIHSSDEGEDQGGEEDEEDEWED
Download sequence
Identical sequences G3VJB6
ENSSHAP00000003271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]