SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003369 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003369
Domain Number 1 Region: 1383-1475
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000012
Family PWWP domain 0.0091
Further Details:      
 
Domain Number 2 Region: 17-80
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000271
Family Methyl-CpG-binding domain, MBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003369   Gene: ENSSHAG00000002961   Transcript: ENSSHAT00000003405
Sequence length 1499
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849620.1:46740:123916:1 gene:ENSSHAG00000002961 transcript:ENSSHAT00000003405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGKECDGGDKDGGLPVQVPVGWQRRVDQNGVLYISPSGSLLSCLEQVKTYLLTDGTCK
CGLECPLILPKVFNFDPGAAVKQRTAEDVKADEDVTKLCIHKRKIIAVATLHKSMEAPHP
SLVLTSPGGGTSATPIVTSRAATPRSMRTKSHEGITNSVMPECKNPFKLMIGTSNTMGRL
YVQELTGSQQQELHSAYPRQRLGSSEHGQKSPYRGSHGGLPSPASSGSQIYGDGSISPRT
DPLGSPDVFTRSNTGFHGAPNSSPIHMNRTPLSPPSVMLHGSPVQSSCAMAGRTNIPLSP
TLTTKSPVMKKPMCNFSANMEIPRAMFHHKPPQGPPPPPPPSCALQKKPLTSEKDPLGIL
DPIPSKPVNQNPILINATNFHSNVHSQVPVMNVSMPPAVVPLPSNLPLPTVKPGHMNHGS
HVQRVQHSASTSLSPSPVTSPVHMIGTGIGRIEASPQRSRSSSTSSDHGNFMMPPVGPQS
TCGGIKCPPRSPRSTIGSPRPSMPSSPSTKPDGLHQYKDIPNPLIAGMSNVLNAPSNAAF
PAASAGSGPLKSQPGLLGMPLNQILNQHNAASFPASSLLSAAAKAQLANQNKLAGNNNSS
SSNSGAVANSGNTEGHSTLNTMFPPTANMLLPTSEGQSGRAALRDKLMSQQKESMRKRKQ
PTTTVLSLLRQSHMDSPAVPKPGPDLIRKQSQGSFPINSMSQLLQSMSCQSSHVSSNSST
GCGSSNPALPCSANQLHFTDTNINSSVLQNSLTQNLPLRGEAMHCQNANTNFMHGSSPGP
NHHLAGLINQIQASGNCGMLSQPGMALGNSLHPNPPQSRISASSTSMIPNSIVSSCNQTS
SDAGGSGPSSSIAIAGTNQPAITKTTSVLQDGVIVTTAAGTPLQSQLPIGSDFPFVGQEH
VLHFPQNSPSNNNLPHPLNPSLLSSLPISLPVNQQHLLNQNLLNILQPSAGEGDMSSINN
TLNNHQLTHLQSLLNSNQMFPSNQQQQQLLHGYQNLQTFQGQPTIPGSGNSSNPMACLFQ
NFQVRMQEDAALLNKRMSTQSGLTALPENSNSTLPPFQDTACELQQRTEPTLGQQAKDSL
NVTGQGDASVDAIYKAVVDAASKGMQVVITTAVSSTTQISPIPALSAMSAFTASIGDPLN
LSSAVSAVIHGRNIGGADHDSRLRNVRGTRLPKNLEHGKNASEGDGFEYFKSAGCNTPKK
LWEEEQSPGGEINRWKCEEFLDHSTHIHSSPCHERPNNVSTLPLLTGEQHPILLPQRNCQ
GDKMLEENFRYNNYKRTMMSFKERLENTVERCAHINGNRPQQSRGFGELLSASKQDLLME
EQSPSSSNSLESSLVKDYIHFNGDFNAKSINGCVPSPSDAKSISSEDDLRNPESPSSNEL
IHYRPRTFNVGDLVWGQIKGLTSWPGKLVREEEVHNSCQQNTEEGKVEPEKLKTLTEGLE
AYSRARKRNRKSGKLNNHLEAAIHEAMSELDKISGNVHQIPQGDRQVKPPKPKRRKISR
Download sequence
Identical sequences G3VJL4
XP_003763895.1.9362 ENSSHAP00000003369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]