SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004391 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004391
Domain Number 1 Region: 71-125
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000308
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004391   Gene: ENSSHAG00000003864   Transcript: ENSSHAT00000004436
Sequence length 133
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849929.1:78016:79516:1 gene:ENSSHAG00000003864 transcript:ENSSHAT00000004436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQAVAERERLLQAREGTKRSKEEARPVPAIMAPPPPPPRPPGPRVLDLYQHLERWGHSPE
SCPHVRVTSGCCRGPLVKVGGRIKTWRKRWFCFDRHARRLAYYADKEETKLKGVIYFQAI
EEVYYDHLRCAFK
Download sequence
Identical sequences G3VMI6
ENSSHAP00000004391 ENSSHAP00000004391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]