SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005227 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005227
Domain Number 1 Region: 1306-1507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-38
Family Laminin G-like module 0.00000018
Further Details:      
 
Domain Number 2 Region: 1082-1223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-19
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 400-418,871-1020
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-16
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 12-76
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000194
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 5 Region: 93-142
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000943
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 6 Region: 435-504
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0059
Further Details:      
 
Domain Number 7 Region: 158-207
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000036
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 8 Region: 688-756
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000366
Family SEA domain 0.0034
Further Details:      
 
Domain Number 9 Region: 1037-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005227   Gene: ENSSHAG00000004574   Transcript: ENSSHAT00000005279
Sequence length 1516
Comment pep:known_by_projection scaffold:DEVIL7.0:GL850263.1:111359:135278:-1 gene:ENSSHAG00000004574 transcript:ENSSHAT00000005279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSDQATPSPCLGVQCPFGATCVVRNWEAVCECQQVCAGLYDPVCGNDGVTYGSPCELEAT
ACVLRKEILVTRKGPCGLCGKCQFGALCEAETGRCVCPTECVASAQPVCGSDGNTYGSEC
ELHVHACTRQINLSVASPGHCKTCGDTVCTFGAVCSNGQCVCPRCERPPPSPVCGSDGIT
YGSNCELREASCQQQKKIEEVRPGPCEDGKWTPEPRTSSRWAPAGPMLHTFSIEKKPLLF
PTPKCGFQNLNHLKRKELKKAKEGKPSRYIALKSNRIFLLFSSFPSLSHMHACMYTLVVC
ICNTYYVVLCPLPGADDAYGPEGSQLCLETAHGGVLTWWALSRVGGGGGRKEECSLSFHP
SFALSSSLVWFSNLNTSQSSCNCDPGGSVRDDCEQMTGLCSCKEGITGMKCSQCPPGSIL
GPSGCENDPSAPKSCAELSCEFGASCVETGDSAHCECPAPVCPEDNMVKVCGSDGVTYGD
PCQLRTIACRQGRTITVRHFGQCHESITHGTPPAQPPTAPSIVTSETVLPSLLRFTSPAP
ETTMTTTWPGRGPQPTPRSRSTTPPPVPAWTTAGVRRTTPRLAAPALGPPPLRLMSLSFG
LGSPGGTCRWGRRPDEARGNSGRPRQLPAHLTNLPPPCLPAIPGPGPLASCAGCTGHRGL
TVSFSPSPPTATKVFQGVLVLEEVEGQELFYTPEMADPKSELFGETARSIESVLEGLFRN
SDVKKDFRSVRMRDLGPGGSVRAIVDAHFDPSTSFTALDVGRALLKQIRASKKRVLVVKQ
PLADHVKFMDFALVPALPGAQGQGRILPPCCAQGTDGLSSPLCRLAPYAVHPSHHHHHRG
HGGPGPKQPHREAPPSIPSVPPPAVQYFVPAFGGRSYLAFPTLRAYHTLRVAMEFRVSEP
HGLMLYNGQSSGKDFIALTLVNGFVELRYGQEVVAPDPQTAQGPVDGEWFQASPGSLSRG
MLSLGCGGGKVGEGPLDPTMPYAPTSSFPGRVSERTSARAGLRGCIRLLDVNNQRIGLRE
KGPDVLYGSGVGECGNNPCLPNPCHHGATCQAREADMFHCQCPKGREGPTCADEKNPCQP
NPCQGAATCRVLPEGGAKCECPMGRGGQFCQTVTEQDLSRPFLPTFSGFSYLELKGLHTC
GVLFYNGQKTDGKGDFVSLALHGGHLEYRYDLGKGAAVIRSKEPITLNKWTRVSLERNGR
KGAMWINDGERVLGESPVSELWESWSELWEATVLMGALTIADRWTRPLPLDSSLGMEVED
IVSLKGRQLLTRENVLDAVEISSFPDHPCTRASGQPCLNGGSCSPQQDTYECLCPGGFSG
AHCEKGLIEKSAADLDAIAFDGRTFIEYHNAVTTSEKALQENHFELSLRTEAMQGLVLWS
GKGTERADYIALAIVNGRLQMTYDLGSQPVVLYSTVPVNTNRWLRVKASRVQREGSLQVG
NEAPVTGSSPLGATQLDTDGALWLGGLEKLNVAHSLPKAYSTGFVGCLRGVVVGQKELHL
VEDALHKPALRHCSAP
Download sequence
Identical sequences G3VPX2
ENSSHAP00000005227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]