SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005228 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005228
Domain Number 1 Region: 1273-1489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-36
Family Laminin G-like module 0.000000409
Further Details:      
 
Domain Number 2 Region: 1060-1196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.09e-19
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 386-404,853-998
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-16
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 4 Region: 12-76
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000194
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 5 Region: 93-142
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000943
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 6 Region: 421-490
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0059
Further Details:      
 
Domain Number 7 Region: 158-207
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 8 Region: 632-700
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000366
Family SEA domain 0.0034
Further Details:      
 
Domain Number 9 Region: 1015-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005228   Gene: ENSSHAG00000004574   Transcript: ENSSHAT00000005280
Sequence length 1512
Comment pep:known_by_projection scaffold:DEVIL7.0:GL850263.1:111359:135278:-1 gene:ENSSHAG00000004574 transcript:ENSSHAT00000005280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSDQATPSPCLGVQCPFGATCVVRNWEAVCECQQVCAGLYDPVCGNDGVTYGSPCELEAT
ACVLRKEILVTRKGPCGLCGKCQFGALCEAETGRCVCPTECVASAQPVCGSDGNTYGSEC
ELHVHACTRQINLSVASPGHCKTCGDTVCTFGAVCSNGQCVCPRCERPPPSPVCGSDGIT
YGSNCELREASCQQQKKIEEVRPGPCEDGKWTPEPRTSSRWAPAGPILVYFPCLPLTGSN
SFQESIFKKRIKKSKSEAANEMICYIALKNACMHVYVGSMYMPEGSQLCLETAHGGVLTW
WALSRVGGGGGRKEECSLSFHPSFALSSSLVWWALLRWCDACPTTSGFSLARGKLLANRH
CQLEPACNCDPGGSVRDDCEQMTGLCSCKEGITGMKCSQCPPGSILGPSGCENDPSAPKS
CAELSCEFGASCVETGDSAHCECPAPVCPEDNMVKVCGSDGVTYGDPCQLRTIACRQGRT
ITVRHFGQCHESITHGTPPAQPPTAPSIVTSETVLPSLLRFTSPAPETTMTTTWPGRGPQ
PTPRSRSTTPPPVPAWTTAGVRRTTPRLAAPAAHLTNLPPPCLPAIPGPGPLASCAGCTG
HRGLTVSFSPSPPTATKVFQGVLVLEEVEGQELFYTPEMADPKSELFGETARSIESVLEG
LFRNSDVKKDFRSVRMRDLGPGGSVRAIVDAHFDPSTSFTALDVGRALLKQIRASKKRVL
VVKQPLADHVKFMDFAWADGGEGRCQPGLLMGGGTRRACWLPLLEGRHWNQGVGALVPAL
PGAQGQGRILPPCCAQGTDGLSSPLCRLAPYAVHPSHHHHHRGHGGPGPKQPHQAPPSIP
SVPPPAVQYFVPAFGGRSYLAFPTLRAYHTLRVAMEFRVSEPHGLMLYNGQSSGKDFIAL
TLVNGFVELRYGQEVVAPDPQTAQGPVDGEWFQASPGSLSRGMLSLGCGGGKVGEGPLDP
TMPYAPTSRVSERTSARAGLRGCIRLLDVNNQRIGLREKGPDVLYGSGVGECGNNPCLPN
PCHHGATCQAREADMFHCQCPKGREGPTCADEKNPCQPNPCQGAATCRVLPEGGAKCECP
MGRGGQFCQTVTEQDLSRPFLPTFSGFSYLELKGLHTCGVLFYNGQKTDGKGDFVSLALH
GGHLEYRYDLGKGAAVIRSKEPITLNKWTRVSLERNGRKGAMWINDGERVLGESPRFNRK
KKKPTILSTRRGLFPPRALGRGARGGAWRPDRTHTLPSVSLKGRQLLTRENVLDAVEISS
FPDHPCTRASGQPCLNGGSCSPQQDTYECLCPGGFSGAHCEKGLIEKSAADLDAIAFDGR
TFIEYHNAVTTSELTNEIPAPDALDSGVLSSEKALQENHFELSLRTEAMQGLVLWSGKGT
ERADYIALAIVNGRLQMTYDLGSQPVVLYSTVPVNTNRWLRVKASRVQREGSLQVGNEAP
VTGSSPLGATQLDTDGALWLGGLEKLNVAHSLPKAYSTGFVGCLRGVVVGQKELHLVEDA
LHKPALRHCSAP
Download sequence
Identical sequences G3VPX3
ENSSHAP00000005228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]