SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005325 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005325
Domain Number 1 Region: 509-684
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-37
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005325   Gene: ENSSHAG00000004654   Transcript: ENSSHAT00000005378
Sequence length 696
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861546.1:114810:127309:1 gene:ENSSHAG00000004654 transcript:ENSSHAT00000005378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTRVGRWLLQDPSSFCPLRPPQDISLEEFDDEDLSEITDDCGIGLNYDSDPCEKDSLSLG
RSEHPHPICSFQDDFQEFEMIDENEEEEEEEDGDGVEDGGHRHEIPPSPPLIPSPSAQEP
QKPRPTTLNLTSLGTQDSLNNNGGYSPPPPATWQDTLLSSPPEESHNGERVERRTIKNEG
RCGVREGSPKPGDLFRGMAGEQRPRELWVKEGVRGAVMEGDWGTVNEGGSAVGRDLLNGR
KGLGVVGEGGEVGSPYCPAFLLAAHRGSHVCTADGHREEQCGPPSGYDCEGNRPREGSEA
SPGHPAAPGSSPDAYTPPPPPPSKSPGGGGEGGSRLYWERGPGLAWGWGLRGPASLVSQR
RQSRPKVLSTVSSTKLRAWTQDEENMGRTGVQQGFHIQFNSRFGILQCTPNSGAGGEKGD
LGSVSGGPSPGTSSSSPPPASFTVSLPPSLYLSFSSSPNSGTESFGLFSCVINGEEREQT
HRAVFRFIPRHADELELDVDDPVLVEAEEDDFWFRGFNMRTGERGIFPAFYAHAVPGPTK
DLLGGKRSPCWVERFNVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLQ
ISLRGVKLSLSGGGPEFERCSHFFQMKNISFCGCHPRNSCYFGFITKHPVLSRFACHVFV
SQESMRPVAQSVGRAFLEYYQEHLEYACPTEDIYLE
Download sequence
Identical sequences G3VQ70
ENSSHAP00000005325 ENSSHAP00000005325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]